Property Summary

NCBI Gene PubMed Count 38
PubMed Score 23.27
PubTator Score 117.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 3.4e-06
group 3 medulloblastoma 2254 9.1e-04

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 3.4e-06
group 3 medulloblastoma 1.100 9.1e-04

Gene RIF (13)

PMID Text
26545775 Colorectal cancer patients with high levels of Thoc1 expression had poorer overall-survival and disease-free survival, whereas those with lower levels of Thoc1 expression survived longer.
25296641 In humans, high THOC1 protein expression associates with prostate cancer aggressiveness and recurrence. Thus, THOC1 protein is a molecular marker that may improve the identification of aggressive prostate cancers, potentially reducing overtreatment.
24682263 Thoc1 inhibits cell growth via induction of cell cycle arrest and apoptosis in lung cancer cells.
23460917 This suggests NEDD4-1 functions in conjunction with other post-translational mechanisms to regulate Thoc1 protein and THO activity.
22952718 overexpression of hTREX84 is associated with cancer cell transformation, proliferation and may be regulated by RelA/p65
22144908 We show that human THO depletion impairs transcription elongation and mRNA export and increases instability associated with DNA breaks, leading to hyper-recombination and gammaH2AX and 53BP1 foci accumulation
21329510 A differential connection between tumorogenesis and the expression levels of human THO and ALY.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18469354 elevated expression of hHpr1/p84/Thoc1 is common in NSCLC and may have prognostic significance in subgroups of patients
17699767 Cells respond to AAV infection by activating two DNA damage signaling cascades. The first activates the p84N5 protein, which in turn activates caspase-6, leading to cell death.
17638875 Thoc1 may be important for neoplastic transformation
15998806 recruitment of the human TREX complex to spliced mRNA is not directly coupled to transcription, but is instead coupled to transcription indirectly through splicing
15870275 hHpr1/p84/Thoc1 regulates transcriptional elongation and may participate in a protein complex functionally analogous to yeast TREX, physically linking elongating RNA polymerase II with RNA processing factors

AA Sequence

MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILEEEIINHSSCE      1 - 70
NVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMC     71 - 140
NDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGM    141 - 210
DVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQ    211 - 280
ASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQS    281 - 350
LWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPE    351 - 420
DFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNS    421 - 490
NYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES    491 - 560
PDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAWQDQEGVHATP    561 - 630
ENLINALNKSGLSDLAESLTNDNETNS                                               631 - 657
//

Text Mined References (53)

PMID Year Title
26545775 2015 Elevated expression of Thoc1 is associated with aggressive phenotype and poor prognosis in colorectal cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25296641 2014 The Thoc1 ribonucleoprotein and prostate cancer progression.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24682263 2014 Thoc1 inhibits cell growth via induction of cell cycle arrest and apoptosis in lung cancer cells.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23460917 2013 The Thoc1 encoded ribonucleoprotein is a substrate for the NEDD4-1 E3 ubiquitin protein ligase.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23222130 2013 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22952718 2012 Transcriptional regulation of hTREX84 in human cancer cells.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22144908 2011 Genome instability and transcription elongation impairment in human cells depleted of THO/TREX.
21329510 2011 Differential expression of THOC1 and ALY mRNP biogenesis/export factors in human cancers.
21269460 2011 Initial characterization of the human central proteome.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19165146 2009 Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
19059247 2009 Nuclear localization of the pre-mRNA associating protein THOC7 depends upon its direct interaction with Fms tyrosine kinase interacting protein (FMIP).
18974867 2008 Recruitment of the complete hTREX complex is required for Kaposi's sarcoma-associated herpesvirus intronless mRNA nuclear export and virus replication.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18469354 2008 Relationships of hHpr1/p84/Thoc1 expression to clinicopathologic characteristics and prognosis in non-small cell lung cancer.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17699767 2007 Cells with defective p53-p21-pRb pathway are susceptible to apoptosis induced by p84N5 via caspase-6.
17638875 2007 Cancer cells and normal cells differ in their requirements for Thoc1.
17190602 2006 Human mRNA export machinery recruited to the 5' end of mRNA.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15998806 2005 Recruitment of the human TREX complex to mRNA during splicing.
15870275 2005 Human hHpr1/p84/Thoc1 regulates transcriptional elongation and physically links RNA polymerase II and RNA processing factors.
15833825 2005 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358532 2004 The death domain protein p84N5, but not the short isoform p84N5s, is cell cycle-regulated and shuttles between the nucleus and the cytoplasm.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14962675 2004 Inversion, duplication, and changes in gene context are associated with human chromosome 18 evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12096345 2002 Nuclear localization is required for induction of apoptotic cell death by the Rb-associated p84N5 death domain protein.
11979277 2002 TREX is a conserved complex coupling transcription with messenger RNA export.
11050087 2001 The nuclear death domain protein p84N5 activates a G2/M cell cycle checkpoint prior to the onset of apoptosis.
10840029 2000 Apoptosis induced by the nuclear death domain protein p84N5 is associated with caspase-6 and NF-kappa B activation.
10512864 1999 Apoptosis induced by the nuclear death domain protein p84N5 is inhibited by association with Rb protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7525595 1994 The amino-terminal region of the retinoblastoma gene product binds a novel nuclear matrix protein that co-localizes to centers for RNA processing.