Property Summary

NCBI Gene PubMed Count 25
PubMed Score 1.99
PubTator Score 15.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer 1.600 1.2e-02
astrocytic glioma -2.500 4.6e-03
ependymoma -2.600 8.9e-03
oligodendroglioma -2.200 1.9e-02
glioblastoma -2.500 2.4e-04
osteosarcoma -3.433 4.4e-05
medulloblastoma -2.500 1.6e-05
atypical teratoid / rhabdoid tumor -2.500 2.6e-06
medulloblastoma, large-cell -2.600 1.1e-02
primitive neuroectodermal tumor -2.500 1.5e-03
tuberculosis 1.400 8.6e-04
sarcoidosis 1.300 4.7e-02
interstitial cystitis 1.700 5.3e-03
pediatric high grade glioma -1.700 2.5e-03
pilocytic astrocytoma -1.600 3.0e-03
primary Sjogren syndrome 1.700 1.2e-03
lung carcinoma -1.700 2.7e-13
psoriasis 1.100 6.2e-20

Gene RIF (11)

PMID Text
25535246 the THEMIS:SHP complex dampens early TCR signalling by a previously unknown molecular mechanism that favours T-cell survival.
23820479 THEMIS showed higher mRNA expression in active celiac disease compared with treated patients and controls.
23460737 THEMIS binding to GRB2 was required for thymocyte development.
22732588 Themis1 exhibits the same potential to restore T cell development and T cell receptor-mediated signaling in Themis1-deficient mice.
22610119 SPOP mutations may define a new molecular subtype of prostate cancer.
21189249 specific role for THEMIS in early TCR signalosome function
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19597499 Functional analysis of the mouse gene by knockout, and comparison of the mouse and human proteins.
19597498 Functional characterization of the homologous mouse gene.

AA Sequence

MALSLEEFVHSLDLRTLPRVLEIQAGIYLEGSIYEMFGNECCFSTGEVIKITGLKVKKIIAEICEQIEGC      1 - 70
ESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNS     71 - 140
VEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWD    141 - 210
STNPFPKDFYGTLILKPVYEIQGVMKFRKDIIRILPSLDVEVKDITDSYDANWFLQLLSTEDLFEMTSKE    211 - 280
FPIVTEVIEAPEGNHLPQSILQPGKTIVIHKKYQASRILASEIRSNFPKRHFLIPTSYKGKFKRRPREFP    281 - 350
TAYDLEIAKSEKEPLHVVATKAFHSPHDKLSSVSVGDQFLVHQSETTEVLCEGIKKVVNVLACEKILKKS    351 - 420
YEAALLPLYMEGGFVEVIHDKKQYPISELCKQFRLPFNVKVSVRDLSIEEDVLAATPGLQLEEDITDSYL    421 - 490
LISDFANPTECWEIPVGRLNMTVQLVSNFSRDAEPFLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKH    491 - 560
PSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAI    561 - 630
AETFKNEKHQK                                                               631 - 641
//

Text Mined References (30)

PMID Year Title
25535246 2015 A THEMIS:SHP1 complex promotes T-cell survival.
24226767 2013 Themis sets the signal threshold for positive and negative selection in T-cell development.
23820479 2014 THEMIS and PTPRK in celiac intestinal mucosa: coexpression in disease and after in vitro gliadin challenge.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23460737 2013 GRB2-mediated recruitment of THEMIS to LAT is essential for thymocyte development.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22732588 2012 Interchangeability of Themis1 and Themis2 in thymocyte development reveals two related proteins with conserved molecular function.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22610119 2012 Exome sequencing identifies recurrent SPOP, FOXA1 and MED12 mutations in prostate cancer.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21189249 2011 T cell receptor (TCR)-induced tyrosine phosphorylation dynamics identifies THEMIS as a new TCR signalosome component.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19805304 2009 Gasp, a Grb2-associating protein, is critical for positive selection of thymocytes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19621038 2009 Themis imposes new law and order on positive selection.
19620281 2009 A novel gene essential for the development of single positive thymocytes.
19597499 2009 Themis controls thymocyte selection through regulation of T cell antigen receptor-mediated signaling.
19597498 2009 Themis, a T cell-specific protein important for late thymocyte development.
19597497 2009 Themis is a member of a new metazoan gene family and is required for the completion of thymocyte positive selection.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.