Property Summary

NCBI Gene PubMed Count 17
PubMed Score 166.19
PubTator Score 35.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Liver carcinoma 217
Disease Target Count P-value
sarcoidosis 368 4.9e-05
osteosarcoma 7933 1.1e-04
atypical teratoid/rhabdoid tumor 1095 5.8e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.918 1.1e-04
atypical teratoid/rhabdoid tumor -1.300 5.8e-04
sarcoidosis -1.200 4.9e-05

 GWAS Trait (1)

Gene RIF (6)

PMID Text
22200884 Suggest that CTMP may therefore play a critical role in mitochondrial-mediated apoptosis in lung cancer cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19679565 Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4.
19604401 Phosphorylation on Ser37/Ser38 of CTMP is important for the prevention of mitochondrial localization of CTMP, eventually leading to cell death by binding to heat shock protein 70.
19168129 Proper maturation of CTMP is essential for its pro-apoptotic function. CTMP delays PKB phosphorylation following cell death induction, suggesting that CTMP regulates apoptosis via inhibition of PKB.
17615157 CTMP induces translocation of Akt to the membrane and thereby increases the level of Akt phosphorylation. As a result, CTMP enhances various cellular activities that are principally mediated by the PI3-kinase/Akt pathway.

AA Sequence

MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED      1 - 70
GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG     71 - 140
GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV    141 - 210
SCNVQSVDEKTLYSEATSLFIKLNPAKSLT                                            211 - 240
//

Text Mined References (23)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
22871024 2012 Correlation of structure and function in the human hotdog-fold enzyme hTHEM4.
22586271 2012 Acyl coenzyme A thioesterase Them5/Acot15 is involved in cardiolipin remodeling and fatty liver development.
22200884 2012 Carboxyl-terminal modulator protein induces apoptosis by regulating mitochondrial function in lung cancer cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19679565 2009 The DNA methylome of pediatric acute lymphoblastic leukemia.
19604401 2009 Heat shock protein 70-mediated sensitization of cells to apoptosis by Carboxyl-Terminal Modulator Protein.
19453107 2009 The Akt C-terminal modulator protein is an acyl-CoA thioesterase of the Hotdog-Fold family.
19421406 2009 The Carboxy-Terminal Modulator Protein (CTMP) regulates mitochondrial dynamics.
19168129 2009 Carboxy-Terminal Modulator Protein (CTMP) is a mitochondrial protein that sensitizes cells to apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17615157 2007 Carboxy-terminal modulator protein induces Akt phosphorylation and activation, thereby enhancing antiapoptotic, glycogen synthetic, and glucose uptake pathways.
17013611 2006 Activation of Akt independent of PTEN and CTMP tumor-suppressor gene mutations in epilepsy-associated Taylor-type focal cortical dysplasias.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15026474 2004 Hypermethylation and transcriptional downregulation of the carboxyl-terminal modulator protein gene in glioblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11598301 2001 Carboxyl-terminal modulator protein (CTMP), a negative regulator of PKB/Akt and v-Akt at the plasma membrane.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.