Property Summary

NCBI Gene PubMed Count 55
PubMed Score 77.92
PubTator Score 49.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
25976449 The THBS4 A387P polymorphism was associated with coronary artery disease in American population.
24941943 Tsp4 functions as an ECM scaffold at myotendinous junctions, with potential therapeutic uses in tendon strengthening and repair
23942617 THBS4 expression in breast cancer-associated extracellular matrix contributes to the activated stromal response exhibited during tumour progression
23420636 the balancing selection target in THBS4 is likely represented by one or more variants that regulate tissue-specific and sex-specific gene expression
22745497 The results of thid study suggested that injury-induced spinal TSP4 may contribute to spinal presynaptic hypersensitivity and neuropathic pain states.
22011848 genetic polymorphism predicts cardiovascular risk in postinfarction patients with high HDL cholesterol and C-reactive protein levels
21701537 Identify THBS4 as a powerful marker for diffuse-type gastric adenocarcinomas and to provide an initial characterization of its expression in the course of this disease.
20846368 High THBS4 methylation resulting in inactivation of the gene is associated with colorectal cancer.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
18178577 The meta-analysis included 6388 (TSP-1), 4930 (TSP-2), and 6978 (TSP-4) cases; none of the polymorphisms was found to be linked with the risk of myocardial infarction.
18178577 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17709521 Observational study of gene-disease association. (HuGE Navigator)
17202846 Observational study of gene-disease association. (HuGE Navigator)
17182969 Gene-expression changes in human evolution that involve specific brain regions, including portions of cerebral cortex.
16923428 Observational study of gene-disease association. (HuGE Navigator)
16923428 Homozygosity for thrombospondin-4 1186C (Arg387Pro) variant is a risk factor for myocardial infarction especially in older women.
16246837 biophysical analysis of roles of signature domains of thrombospondin-4 and thrombospondin-2 in calcium binding, fine structure, and inter-modular interactions
16148025 A387P in thrombospondin-4 and N700S in thrombospondin-1 polymorphisms perturb calcium binding sites
15897551 Promoter hypermethylation of thrombospondin 4 is associated with cutaneous T-cell lymphoma
15474480 thrombospondin-4 C-terminal peptide has a role in stimulating erythroid cell proliferation
15131549 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15121769 Observational study of gene-disease association. (HuGE Navigator)
14674882 Observational study of gene-disease association. (HuGE Navigator)
12482844 Observational study of gene-disease association. (HuGE Navigator)
7490284 The functional analysis of the rat counterpart.

AA Sequence

MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYVISTFKLQTKS      1 - 70
SATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGS     71 - 140
LELYLDCIQVDSVHNLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEP    141 - 210
LAATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPP    211 - 280
APPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRC    281 - 350
DACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKA    351 - 420
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYV    421 - 490
PNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGD    491 - 560
GRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQD    561 - 630
SDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVG    631 - 700
DICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLA    701 - 770
VGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK    771 - 840
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGV    841 - 910
TIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFDN                       911 - 961
//

Text Mined References (59)

PMID Year Title
25976449 2015 Association between single nucleotide polymorphisms in thrombospondins genes and coronary artery disease: A meta-analysis.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25234833 2014 The possible involvement of skin dryness on alterations of the dermal matrix.
24941943 2014 Thrombospondin-4 controls matrix assembly during development and repair of myotendinous junctions.
24787432 2014 Targeted proteomics pipeline reveals potential biomarkers for the diagnosis of metastatic lung cancer in pleural effusion.
23942617 2013 Thrombospondin-4 expression is activated during the stromal response to invasive breast cancer.
23892609 2013 Thrombospondins: old players, new games.
23874812 2013 Plasminogen activator inhibitor-2 polymorphism associates with recurrent coronary event risk in patients with high HDL and C-reactive protein levels.
23801863 2013 Gastric precancerous lesions are associated with gene variants in Helicobacter pylori-susceptible ethnic Malays.
23637781 2013 Elucidating novel serum biomarkers associated with pulmonary tuberculosis treatment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23420636 2013 Long-standing balancing selection in the THBS4 gene: influence on sex-specific brain expression and gray matter volumes in Alzheimer disease.
23287452 2013 ATF6 [corrected] and thrombospondin 4: the dynamic duo of the adaptive endoplasmic reticulum stress response.
22745497 2012 Thrombospondin-4 contributes to spinal sensitization and neuropathic pain states.
22682248 2012 A thrombospondin-dependent pathway for a protective ER stress response.
22380695 2012 Thrombospondin-4, tumour necrosis factor-like weak inducer of apoptosis (TWEAK) and its receptor Fn14: novel extracellular matrix modulating factors in cardiac remodelling.
22011848 2011 Thrombospondin-4 polymorphism (A387P) predicts cardiovascular risk in postinfarction patients with high HDL cholesterol and C-reactive protein levels.
21701537 2011 THBS4, a novel stromal molecule of diffuse-type gastric adenocarcinomas, identified by transcriptome-wide expression profiling.
20846368 2010 Thrombospondin-4 is a putative tumour-suppressor gene in colorectal cancer that exhibits age-related methylation.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19441079 2009 Regulator of differentiation 1 (ROD1) binds to the amphipathic C-terminal peptide of thrombospondin-4 and is involved in its mitogenic activity.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
18802666 2009 Flexible heteroarotinoid (Flex-Het) SHetA2 inhibits angiogenesis in vitro and in vivo.
18178577 2008 Polymorphisms in thrombospondin genes and myocardial infarction: a case-control study and a meta-analysis of available evidence.
17927980 2007 Characterization of extracellular matrix components in the limbal epithelial stem cell compartment.
17709521 2007 Polymorphisms in genes involved in innate immunity predispose toward mycetoma susceptibility.
17202846 2006 Association of common promoter polymorphisms of MCP1 with hepatitis B virus clearance.
17182969 2007 Increased cortical expression of two synaptogenic thrombospondins in human brain evolution.
16923428 2006 Thrombospondin-4 1186G>C (A387P) is a sex-dependent risk factor for myocardial infarction: a large replication study with increased sample size from the same population.
16246837 2005 Biophysical characterization of the signature domains of thrombospondin-4 and thrombospondin-2.
16148025 2005 Polymorphisms A387P in thrombospondin-4 and N700S in thrombospondin-1 perturb calcium binding sites.
16099885 2005 Mechanism and effect of thrombospondin-4 polymorphisms on neutrophil function.
15897551 2005 Epigenetic profiling of cutaneous T-cell lymphoma: promoter hypermethylation of multiple tumor suppressor genes including BCL7a, PTPRG, and p73.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474480 2004 The C-terminal peptide of thrombospondin-4 stimulates erythroid cell proliferation.
15131549 2004 Replication of the association between the thrombospondin-4 A387P polymorphism and myocardial infarction.
15121769 2004 Large scale association analysis for identification of genes underlying premature coronary heart disease: cumulative perspective from analysis of 111 candidate genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14674882 2004 Thrombospondin-4 A387P polymorphism is not associated with coronary artery disease and myocardial infarction in the Chinese Han population.
12952849 2003 Thrombospondin-4 and its variants: expression and differential effects on endothelial cells.
12482844 2002 Thrombospondin-2 polymorphism is associated with a reduced risk of premature myocardial infarction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11967953 2002 Gene expression signature of benign prostatic hyperplasia revealed by cDNA microarray analysis.
11137453 Cultured human retinal pigment epithelial cells differentially express thrombospondin-1, -2, -3, and -4.
10501972 1999 The thrombospondin-4 gene.
8432726 1993 Identification and characterization of thrombospondin-4, a new member of the thrombospondin gene family.
8350346 1993 The evolution of the thrombospondin gene family.
7852353 1995 Characterization of human thrombospondin-4.
7519904 1994 Cell-type specific adhesive interactions of skeletal myoblasts with thrombospondin-1.
7490284 1995 Thrombospondin-4, an extracellular matrix protein expressed in the developing and adult nervous system promotes neurite outgrowth.
6338048 1983 Immunohistochemical localisation of thrombospondin in human megakaryocytes and platelets.