Property Summary

NCBI Gene PubMed Count 17
PubMed Score 32.44
PubTator Score 17.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (2)

PMID Text
17022822 This is the first report of the THBS3 gene working as a stimulator of tumor progression.
11943589 Normal human adult corneal keratocytes have mRNA for this protein.

AA Sequence

METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLSTFRLPPKQGG      1 - 70
VLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADGRTHTVLLRLRGPSRPSPALH     71 - 140
LYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRMQGFVESMKIILGGSMARVGALSECPFQGDE    141 - 210
SIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSP    211 - 280
NPCFRGVDCMEVYEYPGYRCGPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKG    281 - 350
TQVSGVGIDYARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS    351 - 420
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNSG    421 - 490
QEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGD    491 - 560
ACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDADSDLVGDVCDTNEDSDGD    561 - 630
GHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCE    631 - 700
DDFDNDAVVDPLDVCPESAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYT    701 - 770
AFNGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG    771 - 840
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQLVADSGVIIDT    841 - 910
SMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV                            911 - 956
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17022822 2006 Effects of THBS3, SPARC and SPP1 expression on biological behavior and survival in patients with osteosarcoma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943589 2002 Corneal stromal cells (keratocytes) express thrombospondins 2 and 3 in wound repair phenotype.
11137453 Cultured human retinal pigment epithelial cells differentially express thrombospondin-1, -2, -3, and -4.
10527891 1999 The human thrombospondin 3 gene: analysis of transcription initiation and an alternatively spliced transcript.
10329465 1999 Relative abundance of thrombospondin 2 and thrombospondin 3 mRNAs in human tissues.
9331372 1997 Identification of three additional genes contiguous to the glucocerebrosidase locus on chromosome 1q21: implications for Gaucher disease.
8468055 1993 Isolation and characterization of the mouse thrombospondin 3 (Thbs3) gene.
8288588 1994 Thrombospondin 3 is a developmentally regulated heparin binding protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7759526 1995 Thrombospondin 3 is a pentameric molecule held together by interchain disulfide linkage involving two cysteine residues.
7558000 1995 Structure and organization of the human thrombospondin 3 gene (THBS3).
6338048 1983 Immunohistochemical localisation of thrombospondin in human megakaryocytes and platelets.
1601886 1992 Thrombospondin 3 (Thbs3), a new member of the thrombospondin gene family.
1459996 1992 Thrombospondin 1 and thrombospondin 2 are expressed as both homo- and heterotrimers.