Property Summary

NCBI Gene PubMed Count 77
PubMed Score 220.71
PubTator Score 130.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
interstitial lung disease 1.100 3.5e-02
malignant mesothelioma -4.700 4.2e-09
esophageal adenocarcinoma 1.500 4.1e-02
psoriasis -1.400 6.3e-03
group 4 medulloblastoma -2.000 1.3e-04
glioblastoma 1.100 3.6e-03
medulloblastoma, large-cell -1.400 7.4e-04
primary pancreatic ductal adenocarcinoma 4.081 3.0e-06
non-small cell lung cancer 2.850 1.3e-18
intraductal papillary-mucinous adenoma (... -3.000 1.3e-03
intraductal papillary-mucinous carcinoma... -3.200 5.3e-03
lung cancer 1.900 3.2e-05
pancreatic cancer 4.500 3.3e-06
interstitial cystitis -1.800 2.8e-02
lung adenocarcinoma 2.100 5.3e-12
adult high grade glioma 1.300 2.3e-02
atypical teratoid/rhabdoid tumor -1.400 3.8e-04
pilocytic astrocytoma 1.600 1.2e-04
nasopharyngeal carcinoma 1.100 9.6e-04
Breast cancer 2.900 5.7e-12
gastric carcinoma 3.900 1.8e-02
ovarian cancer 2.000 2.5e-04
pituitary cancer -3.400 2.0e-06

Gene RIF (61)

PMID Text
26235673 The level of THBS2 in differentiating stem cells, influences chondrogenic differentiation potential.
26168731 determined if structural differences of the TSPs imparted different effects on vascular smooth muscle cell functions critical to the formation of neointimal hyperplasia
25976449 No association was observed between the THBS2 3' untranslated region polymorphism and coronary artery disease risk.
25771974 Patients whose MPM tissues expressed elevated mRNA levels of BIRC5, DSP, NME2, and THBS2 showed a statistically significant shorter overall survival.
25262009 Study suggests THBS2 is aberrantly expressed in gastric cancer and plays a critical role in cancer progression.
24764155 THBS2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival.
24708169 THBS2 is a salivary biomarker of oral cavity squamous cell carcinoma.
24500070 TSP-2 is a potentially useful biomarker for assessment of disease severity and prognosis in HFrEF.
24374826 Estrogen receptor alpha in cancer-associated fibroblasts suppresses prostate cancer invasion via modulation of thrombospondin 2 and matrix metalloproteinase 3.
23875975 Variants within the thrombospondin 2 (THBS2) gene are not associated with Achilles tendinopathy
23843355 TSP-2 haschondrogenic effects on chondroprogenitor cells via PKCA ERK, p38/MAPK, and Notch signaling pathways.
23807322 Although no SNPs in THBS2 were associated with lumbar spinal stenosis, two haplotypes were significantly associated with disease progression in the Korean population, whereas another haplotype may play a protective role.
23660684 human cytomegalovirus infection induced time-dependent decreases in mRNA and protein expressions of both TSP1 and TSP2 in astrocytes
23470460 TSP2 is down-regulated at PCa tissues and cell lines, especially at stroma compartment, which could be related to prostate cancer progression.
23387388 Upregulation of TSP-2 may be a protective mechanism against inflammation and angiogenesis associated with proliferative diabetic retinopathy (PDR).
22308237 TSP-2 has a protective role against cardiac inflammation, injury, and dysfunction in acute viral myocarditis.
22035575 Calcific aortic stenosis in associated with upregulation of TSP-2 expression, and inactivation of Akt and NF-kappaB.
21949402 Endothelial nitric oxide synthase controls the expression of the angiogenesis inhibitor thrombospondin 2
21762961 Data suggests that the presence of thrombospondin-1 (rs2228262) and thrombospondin-2 (rs8089) variants need not be considered a risk for coronary artery disease or myocardial infarction among South Indians.
21682699 In patients with preeclampsia, we demonstrated 1.7-fold higher tsp-2 compared with control group.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Single-nucleotide polymorphism in THBS2 is associated with coronary atherosclerosis.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20472562 LRP1 and TSP2 stimulate Notch activity by driving trans-endocytosis of the Notch ectodomain into the signal-sending cell
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19631562 the thrombospondin gene 2 T>G single nucleotide polymorphism is decreased only in plaque erosion, with no difference in frequency between other coronary disease and controls
19631562 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19592030 When TSP-2 expression was reduced in tumor- derived pancreatic stellate cells using selective siRNAs, pancreatic cancer cell invasion was inhibited.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19282863 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18955754 A significant correlation between microvessel density and the expression of trombospondin-2 (p=0.009) was found.
18720079 The expression of metastasis inhibitor genes PTEN and thrombospondin 2 was down-regulated in the supraglottic carcinoma tissue with lymph node metastasis.
18718009 TSP-2 was found to be present in some, but not all, annulus cells of the human annulus and the mouse annulus.
18682400 Mutations targeting intermodular interfaces or calcium binding destabilize the thrombospondin-2 signature domain.
18600213 The variant allele of THBS2 is a risk factor for TAA in hypertensive patients, whereas the variant alleles of HSPA8, GPX1, AGT, and TNF are protective against this condition.
18600213 Observational study of gene-disease association. (HuGE Navigator)
18455130 regulation of intervertebral disc ECM metabolism by the THBS2-MMP system plays an essential role in the etiology and pathogenesis of LDH.
18455130 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18178577 The meta-analysis included 6388 (TSP-1), 4930 (TSP-2), and 6978 (TSP-4) cases; none of the polymorphisms was found to be linked with the risk of myocardial infarction.
18178577 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18089612 TSP-2 was inconsistently expressed in uterine fibroids.
18032585 TSP1 and TSP2, together with the VLDLR, initiate a nonapoptotic pathway for maintenance of the normal adult vascular endothelium in a quiescent state.
17638877 EWS/FLI1 has a role in regulating tumor angiogenesis in Ewing's sarcoma via suppression of thrombospondins TSP1 and TSP2
17620335 two mAbs that recognize epitopes that are optimally present when three elements of signature domains of TSP-1 and TSP-2, the EGF-like modules, wire, and the lectin-like module, are in the same protein.
17334638 Observational study of gene-disease association. (HuGE Navigator)
17202846 Observational study of gene-disease association. (HuGE Navigator)
17182969 Gene-expression changes in human evolution that involve specific brain regions, including portions of cerebral cortex.
16246837 biophysical analysis of roles of signature domains of thrombospondin-4 and thrombospondin-2 in calcium binding, fine structure, and inter-modular interactions
16186819 The 2.6-A-resolution crystal structure of the glycosylated signature domain of human THBS2 was discribed.
15347840 results indicate that transforming growth factor TGFbeta1 treatment may regulate angiogenesis in pituitary cells by initially increasing levels of pro-angiogenic growth factor VEGF-A and then stimulating anti-angiogenic thrombospondin -1 and 2 levels
15121769 Observational study of gene-disease association. (HuGE Navigator)
12909644 thrombospondin-1 and thrombospondin-2 have N-terminal regions for binding to alpha6beta1 integrin
12861025 Thrombospondin 2 regulates cell proliferation induced by Rac1 redox-dependent signaling
12824879 Decreased thrombospondin-2 expression is associated with human salivary gland carcinomas
12482844 Observational study of gene-disease association. (HuGE Navigator)
12482844 Homozygosity for the THBS-2 variant allele is significantly associated with a lower risk of premature myocardial infarction.
12358136 All adrenal tissues (control adrenals, nonfunctional adenomas and ACTH-dependent aldosterone-producing adenomas) expressed both TSP1 and TSP2 mRNAs.both TSP1 and TSP2 mRNAs. Correlated closely with the expression of ACTH receptor.
12058057 inhibits microvascular endothelial cell proliferation by a caspase-independent mechanism
11943589 Normal human adult corneal keratocytes have mRNA for this protein.

AA Sequence

MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNADD      1 - 70
LSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGPADTLDLTYWIDGTRHVVSLE     71 - 140
DVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFYEHLQAEKSRMYVAKGSARESHFRGLLQNVH    141 - 210
LVFENSVEDILSKKGCQQGQGAEINAISENTETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQEL    211 - 280
SGLHVLVNQLSENLKRVSNDNQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTIC    281 - 350
HQITCPPATCASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI    351 - 420
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSGRETKACQGAP    421 - 490
CPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQERQMCNKRSCPVDGCLSNPCFP    491 - 560
GAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQ    561 - 630
PVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGW    631 - 700
PNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKD    701 - 770
EVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL    771 - 840
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRD    841 - 910
NCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWV    911 - 980
IRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYW    981 - 1050
EDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKT   1051 - 1120
GYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI                     1121 - 1172
//

Text Mined References (82)

PMID Year Title
26235673 2015 Autocrine Action of Thrombospondin-2 Determines the Chondrogenic Differentiation Potential and Suppresses Hypertrophic Maturation of Human Umbilical Cord Blood-Derived Mesenchymal Stem Cells.
26168731 2015 Thrombospondin-1, -2 and -5 have differential effects on vascular smooth muscle cell physiology.
25976449 2015 Association between single nucleotide polymorphisms in thrombospondins genes and coronary artery disease: A meta-analysis.
25771974 2015 Expression status of candidate genes in mesothelioma tissues and cell lines.
25262009 2014 Down regulation of Thrombospondin2 predicts poor prognosis in patients with gastric cancer.
24764155 2015 Nodal metastasis and survival in oral cancer: Association with protein expression of SLPI, not with LCN2, TACSTD2, or THBS2.
24708169 2014 Secretome profiling of primary cells reveals that THBS2 is a salivary biomarker of oral cavity squamous cell carcinoma.
24500070 2014 Circulating thrombospondin-2 reflects disease severity and predicts outcome of heart failure with reduced ejection fraction.
24374826 2014 Estrogen receptor ? in cancer-associated fibroblasts suppresses prostate cancer invasion via modulation of thrombospondin 2 and matrix metalloproteinase 3.
23875975 2014 Variants within the COMP and THBS2 genes are not associated with Achilles tendinopathy in a case-control study of South African and Australian populations.
23843355 2013 Thrombospondin-2 secreted by human umbilical cord blood-derived mesenchymal stem cells promotes chondrogenic differentiation.
23807322 2014 Progression of lumbar spinal stenosis is influenced by polymorphism of thrombospondin 2 gene in the Korean population.
23660684 2013 Human cytomegalovirus infection modulates thrombospondins 1 and 2 in primary fetal astrocytes.
23470460 2013 Expression analysis of thrombospondin 2 in prostate cancer and benign prostatic hyperplasia.
23387388 2013 Expression of thrombospondin-2 as a marker in proliferative diabetic retinopathy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22308237 2012 Thrombospondin-2 prevents cardiac injury and dysfunction in viral myocarditis through the activation of regulatory T-cells.
22035575 2012 Increased thrombospondin-2 in human fibrosclerotic and stenotic aortic valves.
21949402 2011 Endothelial nitric oxide synthase controls the expression of the angiogenesis inhibitor thrombospondin 2.
21762961 2011 An association study of thrombospondin 1 and 2 SNPs with coronary artery disease and myocardial infarction among South Indians.
21682699 2011 Circulating levels of the anti-angiogenic thrombospondin 2 are elevated in pre-eclampsia.
20714802 2011 CD36-mediated activation of endothelial cell apoptosis by an N-terminal recombinant fragment of thrombospondin-2 inhibits breast cancer growth and metastasis in vivo.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20472562 2010 Low density lipoprotein receptor-related protein-1 (LRP1) regulates thrombospondin-2 (TSP2) enhancement of Notch3 signaling.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19818485 2009 Gabapentin receptor alpha2delta-1 is a neuronal thrombospondin receptor responsible for excitatory CNS synaptogenesis.
19631562 Decreased frequency of the 3'UTR T>G single nucleotide polymorphism of thrombospondin-2 gene in sudden death due to plaque erosion.
19592030 2009 Tumor-derived pancreatic stellate cells promote pancreatic cancer cell invasion through release of thrombospondin-2.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18955754 2008 Microvessel density and CpG island methylation of the THBS2 gene in malignant ovarian tumors.
18720079 2009 Expression profiling of supraglottic carcinoma: PTEN and thrombospondin 2 are associated with inhibition of lymphatic metastasis.
18718009 2008 Disruption of the thrombospondin-2 gene alters the lamellar morphology but does not permit vascularization of the adult mouse lumbar disc.
18682400 2008 Mutations targeting intermodular interfaces or calcium binding destabilize the thrombospondin-2 signature domain.
18600213 2008 Assessment of genetic risk factors for thoracic aortic aneurysm in hypertensive patients.
18499674 2008 Influences of the N700S thrombospondin-1 polymorphism on protein structure and stability.
18455130 2008 A functional polymorphism in THBS2 that affects alternative splicing and MMP binding is associated with lumbar-disc herniation.
18178577 2008 Polymorphisms in thrombospondin genes and myocardial infarction: a case-control study and a meta-analysis of available evidence.
18089612 2007 Thrombospondin-1 and thrombospondin-2 mRNA and TSP-1 and TSP-2 protein expression in uterine fibroids and correlation to the genes COL1A1 and COL3A1 and to the collagen cross-link hydroxyproline.
18032585 2008 Thrombospondins use the VLDL receptor and a nonapoptotic pathway to inhibit cell division in microvascular endothelial cells.
17638877 2007 EWS/FLI1 regulates tumor angiogenesis in Ewing's sarcoma via suppression of thrombospondins.
17620335 2007 Immunochemical analysis of the structure of the signature domains of thrombospondin-1 and thrombospondin-2 in low calcium concentrations.
17334638 2007 Gender differences in the association of gene polymorphisms with type 2 diabetes mellitus.
17202846 2006 Association of common promoter polymorphisms of MCP1 with hepatitis B virus clearance.
17182969 2007 Increased cortical expression of two synaptogenic thrombospondins in human brain evolution.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16246837 2005 Biophysical characterization of the signature domains of thrombospondin-4 and thrombospondin-2.
16186819 2005 Structure of the calcium-rich signature domain of human thrombospondin-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15347840 2004 Regulation of VEGF-A, VEGFR-I, thrombospondin-1, -2, and -3 expression in a human pituitary cell line (HP75) by TGFbeta1, bFGF, and EGF.
15121769 2004 Large scale association analysis for identification of genes underlying premature coronary heart disease: cumulative perspective from analysis of 111 candidate genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14561659 2004 Thrombospondin 2 deficiency in pregnant mice results in premature softening of the uterine cervix.
12909644 2003 Recognition of the N-terminal modules of thrombospondin-1 and thrombospondin-2 by alpha6beta1 integrin.
12861025 2003 Thrombospondin 2 regulates cell proliferation induced by Rac1 redox-dependent signaling.
12824879 2003 Loss of heterozygosity on chromosome 6q correlates with decreased thrombospondin-2 expression in human salivary gland carcinomas.
12732502 2003 Megakaryocytes require thrombospondin-2 for normal platelet formation and function.
12482844 2002 Thrombospondin-2 polymorphism is associated with a reduced risk of premature myocardial infarction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358136 2002 Thrombospondin expression in aldosterone-producing adenomas.
12058057 2002 Thrombospondin 2 inhibits microvascular endothelial cell proliferation by a caspase-independent mechanism.
11980922 2002 Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.
11943589 2002 Corneal stromal cells (keratocytes) express thrombospondins 2 and 3 in wound repair phenotype.
11590138 2001 Disulfide connectivity of recombinant C-terminal region of human thrombospondin 2.
11387198 2001 Thrombospondin-2 plays a protective role in multistep carcinogenesis: a novel host anti-tumor defense mechanism.
11147677 2000 Thrombospondin 2 modulates collagen fibrillogenesis and angiogenesis.
10900205 2000 Thrombospondin type 1 repeats interact with matrix metalloproteinase 2. Regulation of metalloproteinase activity.
10491303 1999 Expression of members of the thrombospondin family by human skeletal tissues and cultured cells.
10329465 1999 Relative abundance of thrombospondin 2 and thrombospondin 3 mRNAs in human tissues.
9442117 1998 Mice that lack thrombospondin 2 display connective tissue abnormalities that are associated with disordered collagen fibrillogenesis, an increased vascular density, and a bleeding diathesis.
9249061 1997 Analysis of the promoter and transcription start sites of the human thrombospondin 2 gene (THBS2).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8406456 1993 Sequence and characterization of the complete human thrombospondin 2 cDNA: potential regulatory role for the 3' untranslated region.
6338048 1983 Immunohistochemical localisation of thrombospondin in human megakaryocytes and platelets.
1737102 1992 Localization of platelet osteonectin at the internal face of the alpha-granule membranes in platelets and megakaryocytes.
1559694 1992 Thrombospondin II: partial cDNA sequence, chromosome location, and expression of a second member of the thrombospondin gene family in humans.
1459996 1992 Thrombospondin 1 and thrombospondin 2 are expressed as both homo- and heterotrimers.
1371676 1992 Thrombospondin sequence motif (CSVTCG) is responsible for CD36 binding.