Property Summary

NCBI Gene PubMed Count 271
PubMed Score 1993.74
PubTator Score 1211.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.356 3.0e-02
aldosterone-producing adenoma -1.161 3.7e-02
Breast cancer -1.200 4.5e-02
breast carcinoma -1.100 2.3e-03
cystic fibrosis -2.605 5.8e-07
group 4 medulloblastoma -1.200 2.0e-04
interstitial cystitis 1.300 1.8e-03
intraductal papillary-mucinous adenoma (... -2.400 2.7e-03
intraductal papillary-mucinous carcinoma... -3.200 9.0e-04
lung adenocarcinoma -1.300 1.6e-15
lung cancer -3.000 4.9e-06
lung carcinoma -1.800 2.7e-12
non-small cell lung cancer -1.828 7.8e-12
ovarian cancer -3.800 2.8e-15
pituitary cancer -2.600 8.8e-07
psoriasis -1.600 5.1e-03
ulcerative colitis 2.900 7.9e-08

Gene RIF (242)

AA Sequence

MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADV      1 - 70
ISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAV     71 - 140
SAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVG    141 - 210
SSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSC    211 - 280
TASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH    281 - 350
CYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN    351 - 420
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDCDSGKVDGGDS    421 - 490
GSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKQGAARAKMEYKCAAPSKE    491 - 560
VVLQHVRTERTPQRL                                                           561 - 575
//

Text Mined References (270)

PMID Year Title