Property Summary

NCBI Gene PubMed Count 251
PubMed Score 1927.44
PubTator Score 1211.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Thrombophilia 37 0.0 4.0
hemolytic-uremic syndrome 28 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -1.600 5.1e-03
cystic fibrosis -2.605 5.8e-07
adrenocortical carcinoma -1.356 3.0e-02
non-small cell lung cancer -1.828 7.8e-12
intraductal papillary-mucinous adenoma (... -2.400 2.7e-03
intraductal papillary-mucinous carcinoma... -3.200 9.0e-04
lung cancer -3.700 2.3e-06
breast carcinoma -1.100 2.3e-03
interstitial cystitis 1.300 1.8e-03
lung adenocarcinoma -2.380 9.3e-11
group 4 medulloblastoma -1.200 2.0e-04
aldosterone-producing adenoma -1.161 3.7e-02
Breast cancer -1.200 4.5e-02
lung carcinoma -1.800 2.7e-12
ulcerative colitis 2.900 7.9e-08
ovarian cancer -3.800 2.8e-15
pituitary cancer -2.600 8.8e-07

Protein-protein Interaction (1)

Gene RIF (222)

PMID Text
26891741 Decreased thrombomodulin expression in preeclampsia may play a role in placental dysfunction in preeclampsia and is possibly caused by an angiogenic imbalance. Hypertension and obesity are associated with thrombomodulin downregulation.
26888356 evidence of association between the -33G/A polymorphism in the TM gene and the risk of myocardial infarction in Asians; the Ala455Val variant was not associated with atherosclerotic risk [meta-analysis]
26634653 Identified Nur77/Nor1 as novel regulators of thrombomodulin expression and function in vascular endothelial cells.
26468766 A minimal TM fragment consisting of the fourth, fifth, and most of the sixth EGF-like domain (TM456m) that has been prepared has much improved solubility, thrombin binding capacity, and anticoagulant activity versus those of previous TM456 constructs.
26338301 Membrane-bound TM in macrophages plays an essential role in the development of abdominal aortic aneurysms by enhancing proinflammatory mediator elaboration, macrophage recruitment, and oxidative stress.
26246110 the functional relevance of the rs3176123 variation and indicate that higher thrombomodulin expression by individuals with the 2729C allele likely accounts for their decreased risk for acute GVHD development and subsequent mortality.
26226255 The presence of THBD proximal promoter polymorphisms do not explain variations in levels of serum and cell-expressed THBD in premature acute coronary syndrome patients in Bahrain.
26179123 The EGF5, 6 domains of thrombomodulin appear to be the major domains for down-regulating the complement system rather than the lectin-like domain during xenogenic stimuli.
26159646 The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility.
25790110 levels of protein C and soluble thrombomodulin in critically ill patients with acute kidney injury
25651160 high-glucose environment reduces the expression of TM and TLR4 in keratinocytes possibly through the action of TNF-alpha, and recombinant sTM can increase the TLR4 expression and promote wound healing under diabetic condition
25643902 The lack of any association between the sTM levels and genetic variants in ARDS suggests that the increased levels of sTM may reflect severity of endothelial damage rather than genetic heterogeneity.
25643141 Report functional difference between membrane-bound and soluble human thrombomodulin regarding blood coagulation and inflammation.
25616220 function and regulation of BDCA3 expression and IFN-lambda production by dendritic cells
25564403 Thrombomodulin mutation is associated with autosomal dominant bleeding disorder.
25497974 Thrombomodulin may modulate allergic responses by inhibiting the activation of both eosinophils and mast cells.
25388665 kinetics of the interaction between serine/threonine-rich domain of thrombomodulin (rTMD23) and FGFR1 were analysed in umbilical vein endothelial cells
25250518 Thrombomodulin is differentially regulated within cultured brain microvascular endothelial cells by cytokines and shear stress.
25238231 Cyclic strain strongly downregulated TM expression in a p38- and receptor tyrosine kinase-dependent manner in aortic endothelial cells.
25225421 THBD SNPs predict mortality of manifest GVHD but not the risk of acquiring GVHD, supporting the hypothesis that endothelial vulnerability contributes to GVHD refractoriness.
25214376 Recombinant thrombomodulin does not impair neutrophil functions.
25149909 The study reports effects of the prothrombin Yukuhashi mutation on thrombomodulin-protein C anticoagulant system.
25144670 Review/Meta-analysis: TM -33G/A and Ala455Val polymorphisms were risk factors for coronary artery disease.
25108690 TM-33G/A and Ala455Val polymorphisms are risk factors for coronary artery disease.
25066897 Arg12 of TAFI plays an important role in thrombomodulin-mediated TAFI activation by thrombin
25039491 IKKbeta regulates endothelial thrombomodulin in a Klf2-dependent manner
24975273 Data suggest vitamin D receptor target genes (THBD; DUSP10, dual specificity phosphatase 10; NRIP1, nuclear receptor interacting protein 1; TRAK1, trafficking protein kinesin binding 1) can be used as markers for response to vitamin D3 supplements.
24918929 hMPV-infected BDCA-1(+) and BDCA-3(+) mDCs induced expansion of Th17 cells, in response to RSV, BDCA-1(+) mDCs induced expansion of Th1 cells and BDCA-3(+) mDCs induced expansion of Th2 cells and Tregs
24910448 Data indicate that blood dendritic cell antigen 3 BDCA3(+) and C-type lectin domain family 9, member A CLEC9A(+) dendritic cells (DC) are of major importance in the induction of anti-viral and anti-tumor immunity.
24886544 Endothelial activation, quantified by plasma levels of thrombomodulin (and angiopoietin-2) plays an important role in the development of acute kidney injury in patients with myocardial infarction.
24886404 TM plays an important role in bladder cancer tumor aggressiveness in vitro and in vivo and is a clinically significant predictor that may represent a suitable therapeutic target for bladder cancer.
24602049 This study aimed to evaluate the effect of gene polymorphisms of CYP2C9, VKORC1, thrombomodulin (THBD) and C-reactive protein (CRP) on the risk of bleeding complications of warfarin at therapeutic INR in Korean patients with mechanical cardiac valves
24573987 thrombomodulin may have a role in severity and outcome of community-acquired pneumonia
24554575 Macro- and microscale variables regulate stent haemodynamics, fibrin deposition and thrombomodulin expression.
24498917 Soluble human thrombomodulin attenuates sinusoidal obstruction syndrome in rat through suppression of high mobility group box 1.
24368584 Thrombomodulin modulates dendritic cells via both antagonism of high mobility group protein B1 and an independent mechanism.
24366193 Results suggest that downregulation of TM plays a crucial role in melanocyte transformation and melanoma progression.
24243921 Serum thrombomodulin and von Willebrand factor levels as a parameter of endothelial dysfunction during the acute phase of acute lymphoblastic leukemia might represent an additional prognostic marker in childhood acute lymphoblastic leukemia.
24136651 The lectin-like domain of TM does not play an important role in the host response to M. tuberculosis infection in mice.
24049150 Activated dendritic cell subsets expressing CD141/CLEA9A/CD1c, likely recruited into the tubulointerstitium, are positioned to play a role in the development of fibrosis and, thus, progression to chronic kidney disease.
24004409 These data suggest that peripheral HMGB1 causes hyperalgesia and that recombinant human thrombomodulin (rhsTM) abolishes HMGB1-dependent hyperalgesia, providing novel evidence for therapeutic usefulness of rhsTM as an analgesic.
23954867 THBD 1418T allele was associated with the increased risk of idiopathic recurrent pregnancy loss.
23950139 Recombinant thrombomodulin suppresses vascular inflammation by inhibiting leukocyte recruitment to endothelium through attenuating Le(y)-mediated adhesion and further protects against atherosclerosis progression.
23918310 Data indicate that thrombomodulin (TM) expression may regulate cell growth and migration in ovarian cancer cells, and suggest that TM may be a novel prognostic and therapeutic target for ovarian cancer.
23881386 Thrombomodulin mediates the migration of cervical cancer cells through the regulation of epithelial-mesenchymal transition biomarkers.
23844043 p53 serves as a key regulator of keratinocyte thrombomodulin expression.
23829893 RSV infection induces a distinct pattern of costimulatory molecule expression and cytokine production by BDCA-1(+) and BDCA-3(+) mDCs, and impairs their ability to stimulate T cell proliferation.
23741007 Loss of EPCR and Thrombomodulin at sites of malaria-infected erythrocytes cytoadherence is detectible in nonfatal cerebral malaria.
23520161 There is an association of thrombomodulin gene expression and venous thromboembolism risk in patient carrying this gene.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of thrombomodulin (THBD) in peptide-treated PBMCs
23383040 severe DV infections induce MIF expression, which in turn stimulates monocytes or endothelial cells to express TM and ICAM-1 via the Erk, JNK MAPK and the PI3K signaling pathways
23292007 Increased methylation levels of THBD is associated with highly active Helicobacter pylori-related gastritis.
23274063 TM is a novel molecule that promotes apoptosis and vascular calcification by regulation of Gas6, presumably via EGF receptor/ERK axis.
23140098 Letter: Plasmin and the thrombin-thrombomodulin complex both contribute to thrombin-activatable fibrinolysis inhibitor activation in whole blood model thrombi.
22985614 Data suggest that children with hypothyroidism exhibit decreased thrombomodulin, decreased TFPI (tissue factor pathway inhibitor), and increased TAFI (thrombin-activatable fibrinolysis inhibitor) in plasma.
22918506 effect of antithrombin (SERPINC1), protein C (PROC), thrombomodulin (THBD) and tissue factor pathway inhibitor (TFPI) single nucleotide polymorphisms (SNPs) on the risk of recurrent pregnancy loss
22903729 FFAs inhibit TM-EPCR-Protein C system in endothelial cells through activating JNK signaling, which may be a mechanism for the prothrombotic state in metabolic syndrome.
22880619 In subjects 49 years of age or younger, the C1418T variant (Ala455Val substitution) of thrombomodulin was significantly associated with coronary artery disease.
22796578 Thrombomodulin upregulates extracellular signal-regulated kinase/myeloid leukemia cell-1 signaling to protect endothelial cells from calcineurin inhibitor-induced toxicity.
22750541 Data indicate that protein C (PC) to activated protein C (APC) conversion is dependent upon Thrombomodulin (TM) concentration.
22734102 TM 1418C/T polymorphism is independent predictor of AMI and synergies with smoking.
22689672 loss of endothelial thrombomodulin expression rather than excessive T-cell infiltration associates with steroid-refractory graft-versus-host disease and mortality.
22682121 Mechanisms coupling thrombomodulin to tumor dissemination
22593542 TM interacts with ezrin. TM cytoplasmic domain directly interacts with the N-terminal domain of ezrin
22573811 we conclude that monocytic membrane-bound thrombomodulin participates in the LPS- and gram-negative bacteria-induced inflammatory response.
22533488 results showed increased TM levels in synovial fluid and dramatically impaired expression of TM on synovial cells, suggesting a massive release of TM into the synovial fluid in haemophilic arthropathy
22496090 Recombinant human thrombomodulin may be an effective adjunctive therapy in the management of DIC related to PPH.
22426543 Our findings suggest a close relationship between the expression of thrombomodulin and microhemorrhage in vestibular schwannoma.
22410019 results suggest that thrombomodulin may improve the viability of liver grafts from non-heart-beating donors.
22232927 The results made it possible to assume that the F7 and THBD genes play an important role in genetic predisposition to unfavorable outcomes in patients with a history of acute ischemic heart disease.
22206250 [review] TM binds thrombin, changing thrombin's substrate specificity from procoagulant and pro-inflammatory to anti-coagulant and anti-inflammatory.
21911804 Thrombomodulin gene variants are associated with increased mortality after coronary artery bypass surgery.
21896842 Long-term exposure to a physiological shear stress in the retinal arterioles up-regulated eNOS and thrombomodulin mRNA expressions and downregulated ET-1 mRNA expression in retinal endothelial cells.
21890178 MIF may affect blood coagulation and anticoagulation through its influence on endothelial cell ICAM-1 and thrombomodulin expression.
21833011 Thrombomodulin and RHBDL2 are upregulated in human HaCaT cells stimulated by scratch wounds; furthermore, increased solulbe thrombomodulin was found in culture medium.
21828042 HNK-1ST may be responsible for regulating the sorting of alpha- and beta-TM.
21805323 Alterations in expression of TM and its partner proteins may be manifest by inflammatory and thrombotic disorders.
21774968 The highly diminished delaying effect of TM on FXIII activation and on the cross-linking of fibrin in FV(Leiden) carriers might represent a novel mechanism contributing to the increased thrombosis risk of these individuals.
21556780 Increased UT-II, sTM, and vWF in ankylosing spondylitis patient sera regardless of treatment and disease activity suggest an increased tendency for atherosclerosis.
21489980 methylation of the TM promoter is responsible for silencing of TM expression in MM tissue, a process that is regulated by PARP1.
21466416 These data indicate that TM-overexpression has the potential to improve the antithrombotic performance of patient-derived endothelial progenitor cell for endothelialization applications.
21423464 Paclitaxel downregulates thrombomodulin expression in aortic endothelial cells.
21370217 It appears that the elevation in plasma TM is not related to renal or hepatic dysfunction in pre-eclampsia. It is more likely that plasma TM is derived from placental or vascular endothelial cells subsequent to activation or damage
21239103 transcription of thrombomodulin mRNA was 1.28 times higher in myometrial tissue than in myoma. Anticoagulation/fibrinolytic functions may be higher in myometrium than in fibroids. This may be an explanation for mechanism of uterine artery occlusion
21150180 Serum TM and vWF levels might represent additional, but not independent, prognostic markers in childhood ALL.
21041299 PF4 is shown to inhibit activation of TAFI by thrombin-thrombomodulin
20713448 TM, a novel downstream target of Snail in epithelial-mesenchymal transition, is required for maintaining epithelial morphology and functions as a tumor suppressor.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627281 Case Reports: HELLP syndrome complicated by disseminated intravascular coagulation that developed after delivery and were successfully treated using recombinant TM.
20581778 The aim of the study was to see if there is a difference in the values of Thm and beta2-GPI in children with ischemic stroke.
20542541 The plasma aTAFI and thrombomodulin levels do not seem to be related with the presence of thrombosis observed in Behcet disease.
20538124 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20513133 Observational study of gene-disease association. (HuGE Navigator)
20505198 PDGF-BB induced Thrombomodulin mRNA expression in scleral and corneal stromal cells, but Western blot analysis revealed the increase in TM expression only in the scleral cells.
20479117 A population of human dendritic cells (DC) that expresses DNGR-1 (CLEC9A) and high levels of BDCA3 and resembles mouse CD8alpha+ DCs in phenotype and function, is characterized.
20479116 The first detailed functional analysis of the human CD141+ dendritic cell subset, is reported.
20479115 CD141+ dendritic cells are the only cells in human blood that express the chemokine receptor XCR1 and respond to the specific ligand XCL1 by Ca2+ mobilization and potent chemotaxis.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20309589 glucose upregulate TM mRNA and protein expression.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20128871 Observational study of gene-disease association. (HuGE Navigator)
20116378 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20051099 Reduction of 45% of thrombomodulin expression in spontaneous miscarriage group respect the control groups.
20036902 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900089 Eight of the 37 cases (22%) of GISTs showed cytoplasmic staining for thrombomodulin
19682239 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19656282 The 2.4 A structure of thrombin complexed with EGF domains 4-6 of thrombomodulin shows an altered conformation of thrombin similarly to Na(+) coordination, ordering of the Na(+) binding loop & opening of the adjacent S1 pocket.
19638712 Report increased P-selectin expression on platelets and decreased plasma thrombomodulin in Fontan patients.
19625716 Mutations that impair the function of thrombomodulin occur in about 5% of patients with atypical hemolytic-uremic syndrome
19625716 Observational study of gene-disease association. (HuGE Navigator)
19609862 Atorvastin induces THBD expression in TNFalpha-treated human aortic endothelial cells.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19477487 TM levels were significantly elevated in end-stage renal disease patients compared to controls
19436051 significantly increased expression of EPCR and TM in the valvular sinus endothelium as opposed to the vein lumenal endothelium, and the opposite pattern with VWF
19420105 Observational study of gene-disease association. (HuGE Navigator)
19356953 Expression of t-PA, PAI-1, TF, TFPI, TM, CD68 and VE-cadherin were significantly increased in the early symptomatic group, but the level of gene expression in the late symptomatic group was indistinguishable from the asymptomatic group.
19278588 Complement C5a can depress the gene expression of thrombomodulin in endothelial cells in vitro.
19238444 HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
19133039 Observational study of genotype prevalence. (HuGE Navigator)
19091791 Ets-1 mediates platelet-derived growth factor-BB-induced thrombomodulin expression in human vascular smooth muscle cells.
19074424 The roles of selected arginine and lysine residues of TAFI (Pro-CPU) in its activation to TAFIa by the thrombin-thrombomodulin complex.
19055859 Global fibrinolytic capacity and TM levels were significantly higher in the Legg-Calve-Perthes disease patients
18991188 Changes in nailfold capillaroscopy, endothelial cell activation markers (VEGF, endothelin-1, E-selectin, and thrombomodulin) and features of systemic lupus erythematosus suggest microvascular abnormalities in the clinical manifestation of the disease.
18977990 Observational study of gene-disease association. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18947863 Allergen-enhanced thrombomodulin (blood dendritic cell antigen 3, CD141) expression on dendritic cells is associated with a TH2-skewed immune response
18940182 TM may play an important role in exerting cytoprotective effect on epidermal keratinocytes against low-dose UVB.
18590927 Impaired binding of thrombin to thrombomodulin is associated with risk of deep vein thrombosis.
18579691 HuR plays an important role in suppression of TM protein synthesis in IL-1beta treatment and sepsis
18568955 Thrombin downregulates THBD expression and activiy in primary endothelial cells.
18484695 Higher serum concentrations of endothelin-1 (ET-1), E-selectin, and Thrombomodulin were observed in SLE patients in comparison with controls
18373234 Decreased plasma sTM concentration is associated with an increased risk of PTE in women
18204921 Our results suggest that these three thrombomodulin gene polymorphisms do not contribute to sTM level variations and are not associated with risk of brain infarction and mortality after stroke.
18204921 Observational study of gene-disease association. (HuGE Navigator)
18035074 Observational study of gene-disease association. (HuGE Navigator)
17982464 Thrombomodulin-dependent activated protein C formation mediates cytoprotection in diabetic nephropathy by inhibiting glomerular apoptosis.
17895503 a significant correlation between thrombomodulin and severe preeclampsia and between population ethnicity and thrombomodulin level
17875054 In chronic bronchitis, exercise induced increases in circulating TM levels correlate with elevations in VEGF level which affects functional properties of endothelial cells in pulmonary microvessels in inflamed airways.
17849052 Thrombin-thrombomodulin-mediated degradation of protein C by epithelial/endothelial cell suggests a previously unrecognized mechanism, which can contribute to protein C consumption.
17848551 peripheral clock in vascular endothelial cells regulates TM gene expression and that the oscillation of TM expression may contribute to the circadian variation of cardiovascular events
17702963 Observational study of gene-disease association. (HuGE Navigator)
17677000 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17287633 LPS down-regulates the THRM expression of monocytes and NFKB is a critical mediator of the repression of THRM by LPS. Regulation of the THRM expression by LPS depends on the presence of serum.
17278618 Observational study of genotype prevalence. (HuGE Navigator)
17275499 The endothelial reperfusion injury after liver transplantation shows an increase in thrombomodulin.
17195062 Levels of thrombomodulin are inversely associated with the risk of type 2 diabetes.
17099210 Observational study of gene-disease association. (HuGE Navigator)
17099210 mutations in the TM are not a major cause of recurrent miscarriage although they may exert a modifier effect in combination with other variants.
17099142 Release of EPCR and TM into the conditioned medium was inhibited by the metalloproteinase inhibitors (TAPI) and GM6001, indicating that the shedding of EPCR and TM from the alveolar epithelium is mediated by a metalloproteinase.
17067436 study disclosed for the first time significantly higher increments in the circulating levels of thrombomodulin in familial Mediterranean fever
17049585 possible role for high levels of thrombomodulin as a marker of HCC development in patients with cirrhosis, whereas high levels of EPCR are a possible marker of worse HCC prognosis, being a sign of endothelial damage of large vessels
17003923 Observational study of genotype prevalence. (HuGE Navigator)
16507317 Observational study of gene-disease association. (HuGE Navigator)
16507317 thrombomodulin mutations, especially those with a haplotype consisting of 2729A>C and A455V missense mutation, affect sTM levels, and may be associated with deep vein thrombosis in Japanese
16456088 Observational study of gene-disease association. (HuGE Navigator)
16418283 TM functions by alleviating the Ca(2+)-dependent inhibitory interactions of Arg-67 of protein C and Arg-35 of thrombin
16307806 Increasing plasma TM predicts worse clinical outcome in acute coronary syndromes.
16153429 CRP significantly decreases the expression of TM and EPCR in human endothelial cells, thereby promoting thrombogenic conditions.
16136486 Thrombomodulin (TM) expression in the stem villous vasculature and syncytiotrophoblast of the placenta is impaired in severe preeclampsia
16126727 thrombomodulin induces Ca2+ signals and nitric oxide synthesis through EGFR and calmodulin kinase II
16043642 Statin-dependent induction of eNOS and thrombomodulin requires KLF2 and thereby provides a novel molecular target for modulating endothelial function in vascular disease.
15897668 Elevation of adiponectin may be a defense mechanism against endothelial damage, reflected by elevated CD146 and thrombomodulin.
15842356 Observational study of gene-disease association. (HuGE Navigator)
15842356 Thrombomodulin gene polymorphisms do not have a role in venous thromboembolism
15837080 Observational study of gene-disease association. (HuGE Navigator)
15714116 Lack of thrombomodulin expression due to methylation of the promoter CpG island is associated with malignant melanoma
15705565 PC interactions with thrombin and thrombomodulin are likely contribute in a secondary or minor way to protein substrate affinity
15677570 mechanism involving competition by NF-kappaB for limited pools of the transcriptional coactivator p300 necessary for TM gene expression
15613027 The profibrinolytic effect of plasma TM may contribute to the bleeding tendency observed in some factor XI -deficient patients
15582990 mechanism of thrombomodulin action is to kinetically facilitate the productive encounter of thrombin and protein C and to allosterically change the conformation of the activation peptide of protein C for optimal presentation to the thrombin active site
15574195 Observational study of gene-disease association. (HuGE Navigator)
15574195 Among women aged 15 to 44 years, the A Allele genotype is more prevalent among blacks than whites and is associated with increased risk of early onset ischemic stroke
15488871 Observational study of gene-disease association. (HuGE Navigator)
15183044 Observational study of gene-disease association. (HuGE Navigator)
15183044 identified 10 point mutations and 2 small deletions in the promoter region in 182 patients with acute coronary syndrome
15178554 Review. TM, APC, & EPCR impact coagulation, inflammation, fibrinolysis, & cell proliferation. We review the functions of this complex multimolecular system & how its components maintain homeostasis under hypercoagulable &/or proinflammatory conditions.
15135268 Observational study of gene-disease association. (HuGE Navigator)
15099291 TM was found on the surace of islet cells as well as vascular endothelial cells, whereas no TM was found in the components of exocrine pancreas
15080580 Thrombomodulin may not play an important inflammation-related role in plaque development.
14987915 Role of thrombomodul in the pathogenesis of coagulopathy or thrombosis in cyanotic congenital heart disease
14983241 variation in the promoter region of thrombomodulin (V/delTT) is associated with an elevated risk for myocardial infarct in Northern but not in Southern Europeans
14769148 posttranscriptional downregulation of TM mRNA by IFN-gamma that identifies the 3'-UTR as a target of IFN-gamma-stimulated destabilization
14715348 Observational study of gene-disease association. (HuGE Navigator)
14556624 An interdomain connection modulated by the methionine linker residue at position 388 between the fourth and fifth domains of thrombomodulin is critical for thrombin-binding and anticoagulant cofactor activity.
14523329 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12951323 TM can function as a Ca2+-dependent cell-to-cell adhesion molecule. Binding of specific carbohydrates to the lectin-like domain is essential for this specific function
12920633 the Stx2-induced decrease of TM expression in glomerular endothelial cells might contribute to the local procoagulant state present in hemolytic uremic syndrome
12918732 Behcet's disease with vascular complications involves higher levels of thrombomodulin.
12871600 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12871544 Observational study of gene-disease association. (HuGE Navigator)
12862205 thrombomodulin level may be a molecular marker of the latent progression of atherosclerosis in hypertensive patients
12831611 The increase of thrombomodulin secretion results in homeostatic disturbance, which might be one of the important mechanims of multiple organs dysfunction syndrome.
12709053 Results show that VR1 is a subsite of exosite 1 on thrombin's surface, which regulates exclusive binding of either plasminogen activator inhibitor 1 or thrombomodulin.
12576329 results suggest that oxidized phospholipids inhibit transcription of the thrombomodulin gene in vascular endothelium by inhibiting the binding of retinoic acid receptor beta-retinoid x receptor alpha heterodimer and Sp1 and Sp3 to thrombomodulin promoter
12407115 thrombomodulin-dependent activation of protein C is regulated by Smad6 and Smad7
12297717 Observational study of gene-disease association. (HuGE Navigator)
12210386 Reduced thrombomodulin in human peripheral nerve microvasculature
12204814 Thrombomodulin gene mutation of the 5'-regulatory region might constitute risks for arterial and venous thromboses.
12139752 Observational study of gene-disease association. (HuGE Navigator)
12135317 Observational study of gene-disease association. (HuGE Navigator)
12068020 functional epitope of thrombin recognizing thrombomodulin was mapped using Ala-scanning mutagenesis of 54 residues located around the active site, the Na(+) binding loop, the 186-loop, the autolysis loop, exosite I, and exosite II
12066950 Observational study of gene-disease association. (HuGE Navigator)
12031986 substantial reduction of vascular endothelial thrombomodulin expression throughout human diabetic neuropathy may contribute to microvascular ischemia in the pathogenesis of diabetic neuropathy
11986219 Naturally occurring mutations in the thrombomodulin gene result in impaired function
11864708 Arsenite caused a decrease of t-PA mRNA level and a rise of both PAI-1 mRNA level and activity in microvascular endothelial cells, but not umbilical vein endothelial cells, suggesting a role in Blackfoot disease, a peripheral vascular occlusive disease.
11864703 vWF and tPAag but not thrombomodulin in the present population are independent markers of atherosclerosis.
11858479 Pts with low soluble thrombomodulin levels had a significantly increased risk of hemorrhagic but not ischemic stroke.
11848462 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11848462 Smoking carriers of the THRM -33G/A polymorphism had a nearly 10-fold increased risk of young AMI compared with nonsmoking non-carriers. The prothrombotic milieu due to decreased THRM expression in this polymorphism may be an important mechanism of AMI.
11846431 Establishment of a standard assay method for human thrombomodulin and determination of the activity of the Japanese reference standard
11734675 association between decreased pulmonary endothelial cell thrombomodulin and local fibrin deposition in pneumonia
11642722 a tumor marker for cardiac myxoma
11552992 Observational study of gene-disease association. (HuGE Navigator)
11257274 Observational study of gene-disease association. (HuGE Navigator)
11245641 Observational study of gene-disease association. (HuGE Navigator)
11231927 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADV      1 - 70
ISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAV     71 - 140
SAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVG    141 - 210
SSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSC    211 - 280
TASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH    281 - 350
CYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN    351 - 420
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDCDSGKVDGGDS    421 - 490
GSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKQGAARAKMEYKCAAPSKE    491 - 560
VVLQHVRTERTPQRL                                                           561 - 575
//

Text Mined References (251)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26891741 2016 Loss of Thrombomodulin in Placental Dysfunction in Preeclampsia.
26888356 2016 Association of Thrombomodulin Gene Polymorphisms with Susceptibility to Atherosclerotic Diseases: A Meta-Analysis.
26634653 2016 Antithrombotic Effects of Nur77 and Nor1 Are Mediated Through Upregulating Thrombomodulin Expression in Endothelial Cells.
26468766 2015 Thrombomodulin Binding Selects the Catalytically Active Form of Thrombin.
26338301 2015 Membrane-Bound Thrombomodulin Regulates Macrophage Inflammation in Abdominal Aortic Aneurysm.
26246110 2015 A donor thrombomodulin gene variation predicts graft-versus-host disease development and mortality after bone marrow transplantation.
26226255 2015 Thrombomodulin gene proximal promoter polymorphisms in premature acute coronary syndrome patients in Bahrain.
26179123 Human thrombomodulin regulates complement activation as well as the coagulation cascade in xeno-immune response.
26159646 2015 Variants in the Atherogenic ALOX5AP, THBD, and KNG1 Genes Potentiate the Risk of Ischemic Stroke via a Genetic Main Effect and Epistatic Interactions in a Chinese Population.
25790110 2015 Levels of protein C and soluble thrombomodulin in critically ill patients with acute kidney injury: a multicenter prospective observational study.
25651160 2015 Thrombomodulin promotes diabetic wound healing by regulating toll-like receptor 4 expression.
25643902 2015 Plasma soluble thrombomodulin levels are associated with mortality in the acute respiratory distress syndrome.
25643141 2015 Functional difference between membrane-bound and soluble human thrombomodulin.
25616220 2015 BDCA3 expression is associated with high IFN-? production by CD34(+)-derived dendritic cells generated in the presence of GM-CSF, IL-4, and/or TGF-?.
25564403 2015 Characterization of an autosomal dominant bleeding disorder caused by a thrombomodulin mutation.
25497974 2015 Thrombomodulin inhibits the activation of eosinophils and mast cells.
25388665 2015 FGFR1 mediates recombinant thrombomodulin domain-induced angiogenesis.
25250518 2015 Thrombomodulin regulation in human brain microvascular endothelial cells in vitro: role of cytokines and shear stress.
25238231 2014 Regulation of thrombomodulin expression and release in human aortic endothelial cells by cyclic strain.
25225421 2014 Single-Nucleotide Polymorphisms Within the Thrombomodulin Gene (THBD) Predict Mortality in Patients With Graft-Versus-Host Disease.
25214376 2015 Recombinant thrombomodulin does not impair neutrophil functions.
25149909 2014 Antithrombin-resistant prothrombin Yukuhashi mutation also causes thrombomodulin resistance in fibrinogen clotting but not in protein C activation.
25144670 2015 Thrombomodulin -33G/A and Ala455Val polymorphisms are associated with the risk of coronary artery disease: a meta-analysis including 12?584 patients.
25108690 2014 Association between thrombomodulin polymorphisms and coronary artery disease risk: a meta-analysis.
25066897 2014 A role for arginine-12 in thrombin-thrombomodulin-mediated activation of thrombin-activatable fibrinolysis inhibitor.
25039491 2014 IKK? regulates endothelial thrombomodulin in a Klf2-dependent manner.
24975273 2014 Changes in vitamin D target gene expression in adipose tissue monitor the vitamin D response of human individuals.
24918929 2014 Paramyxovirus infection regulates T cell responses by BDCA-1+ and BDCA-3+ myeloid dendritic cells.
24910448 2015 BDCA3(+)CLEC9A(+) human dendritic cell function and development.
24886544 2014 Elevated plasma thrombomodulin and angiopoietin-2 predict the development of acute kidney injury in patients with acute myocardial infarction.
24886404 2014 Thrombomodulin expression regulates tumorigenesis in bladder cancer.
24602049 2014 Association of gene polymorphisms with the risk of warfarin bleeding complications at therapeutic INR in patients with mechanical cardiac valves.
24573987 2014 Soluble thrombomodulin to evaluate the severity and outcome of community-acquired pneumonia.
24554575 2014 Macro- and microscale variables regulate stent haemodynamics, fibrin deposition and thrombomodulin expression.
24498917 2014 Soluble thrombomodulin attenuates sinusoidal obstruction syndrome in rat through suppression of high mobility group box 1.
24368584 2014 Thrombomodulin modulates dendritic cells via both antagonism of high mobility group protein B1 and an independent mechanism.
24366193 2014 Thrombomodulin modulates cell migration in human melanoma cell lines.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24243921 2014 Prognostic value of plasma levels of thrombomodulin and von Willebrand factor in Egyptian children with acute lymphoblastic leukemia.
24136651 2014 The thrombomodulin lectin-like domain does not change host responses to tuberculosis.
24049150 2013 Increased tubulointerstitial recruitment of human CD141(hi) CLEC9A(+) and CD1c(+) myeloid dendritic cell subsets in renal fibrosis and chronic kidney disease.
24004409 2013 Recombinant human soluble thrombomodulin prevents peripheral HMGB1-dependent hyperalgesia in rats.
23954867 2013 The association of idiopathic recurrent pregnancy loss with polymorphisms in hemostasis-related genes.
23950139 2013 Recombinant lectin-like domain of thrombomodulin suppresses vascular inflammation by reducing leukocyte recruitment via interacting with Lewis Y on endothelial cells.
23918310 2013 Thrombomodulin mediates the progression of epithelial ovarian cancer cells.
23881386 2014 Thrombomodulin mediates the migration of cervical cancer cells through the regulation of epithelial-mesenchymal transition biomarkers.
23844043 2013 UVB irradiation regulates ERK1/2- and p53-dependent thrombomodulin expression in human keratinocytes.
23829893 2013 Differential response of BDCA-1+ and BDCA-3+ myeloid dendritic cells to respiratory syncytial virus infection.
23741007 2013 Loss of endothelial protein C receptors links coagulation and inflammation to parasite sequestration in cerebral malaria in African children.
23520161 2013 Association of the thrombomodulin gene c.1418C>T polymorphism with thrombomodulin levels and with venous thrombosis risk.
23383040 2013 Dengue virus enhances thrombomodulin and ICAM-1 expression through the macrophage migration inhibitory factor induction of the MAPK and PI3K signaling pathways.
23292007 2013 Altered mucosal DNA methylation in parallel with highly active Helicobacter pylori-related gastritis.
23274063 2013 Thrombomodulin, a novel molecule regulating inorganic phosphate-induced vascular smooth muscle cell calcification.
23140098 2013 Plasmin and the thrombin-thrombomodulin complex both contribute to thrombin-activatable fibrinolysis inhibitor activation in whole blood model thrombi.
22985614 2012 Increased thrombin-activatable fibrinolysis inhibitor and decreased tissue factor pathway inhibitor and thrombomodulin levels in children with hypothyroidism.
22918506 2012 Polymorphisms in antithrombin and in tissue factor pathway inhibitor genes are associated with recurrent pregnancy loss.
22903729 2012 Free fatty acids inhibit TM-EPCR expression through JNK pathway: an implication for the development of the prothrombotic state in metabolic syndrome.
22880619 2012 Role of thrombomodulin gene in Indian population with coronary artery disease.
22796578 2012 Thrombomodulin protects endothelial cells from a calcineurin inhibitor-induced cytotoxicity by upregulation of extracellular signal-regulated kinase/myeloid leukemia cell-1 signaling.
22750541 2012 Quantitative analysis of thrombomodulin-mediated conversion of protein C to APC: translation from in vitro to in vivo.
22734102 Association of thrombomodulin gene polymorphisms and plasma thrombomodulin levels with acute myocardial infarction in north Indian patients.
22689672 2012 Loss of endothelial thrombomodulin predicts response to steroid therapy and survival in acute intestinal graft-versus-host disease.
22682121 2012 Mechanisms coupling thrombomodulin to tumor dissemination.
22593542 2012 Thrombomodulin is an ezrin-interacting protein that controls epithelial morphology and promotes collective cell migration.
22573811 2012 Monocytic thrombomodulin triggers LPS- and gram-negative bacteria-induced inflammatory response.
22533488 2012 The potential role of synovial thrombomodulin in the pathophysiology of joint bleeds in haemophilia.
22496090 2013 Efficacy of recombinant human soluble thrombomodulin in severe postpartum hemorrhage with disseminated intravascular coagulation.
22426543 2013 Immunohistochemical expression of thrombomodulin in vestibular schwannoma.
22410019 2012 Recombinant human soluble thrombomodulin (ART-123) prevents warm ischemia-reperfusion injury in liver grafts from non-heart-beating donors.
22232927 2011 [Polymorphic markers Ala455Val of the THBD gene and Arg353Gln of the F7 gene and association with unfavorable outcomes of coronary atherosclerosis in patients with a history of acute ischemic heart disease].
22206250 2012 Thrombomodulin links coagulation to inflammation and immunity.
21911804 2011 Thrombomodulin gene variants are associated with increased mortality after coronary artery bypass surgery in replicated analyses.
21896842 2011 Effects of shear stress on the gene expressions of endothelial nitric oxide synthase, endothelin-1, and thrombomodulin in human retinal microvascular endothelial cells.
21890178 2012 Macrophage migration inhibitory factor induces ICAM-1and thrombomobulin expression in vitro.
21833011 2011 Functions of rhomboid family protease RHBDL2 and thrombomodulin in wound healing.
21828042 2011 Involvement of human natural killer-1 (HNK-1) sulfotransferase in the biosynthesis of the GlcUA(3-O-sulfate)-Gal-Gal-Xyl tetrasaccharide found in ?-thrombomodulin from human urine.
21805323 2012 Thrombomodulin and its role in inflammation.
21774968 2012 Thrombomodulin-dependent effect of factor VLeiden mutation on factor XIII activation.
21556780 2012 Evaluation of various endothelial biomarkers in ankylosing spondylitis.
21489980 2011 Thrombomodulin is silenced in malignant mesothelioma by a poly(ADP-ribose) polymerase-1-mediated epigenetic mechanism.
21466416 2011 In vitro functional testing of endothelial progenitor cells that overexpress thrombomodulin.
21423464 2011 Paclitaxel induces thrombomodulin downregulation in human aortic endothelial cells.
21370217 2011 Sources of thrombomodulin in pre-eclampsia: renal dysfunction or endothelial damage?
21239103 2011 Correlation of thrombomodulin expression and occlusion of the uterine artery for the treatment of leiomyoma.
21150180 2011 Thrombomodulin and von Willebrand factor: relation to endothelial dysfunction and disease outcome in children with acute lymphoblastic leukemia.
21041299 2011 Platelet factor 4 inhibits thrombomodulin-dependent activation of thrombin-activatable fibrinolysis inhibitor (TAFI) by thrombin.
20713448 2010 Downregulation of thrombomodulin, a novel target of Snail, induces tumorigenesis through epithelial-mesenchymal transition.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627281 2010 Use of recombinant human soluble thrombomodulin in the management of HELLP syndrome complicated by DIC.
20581778 2010 Thrombomodulin and antibeta2-glycoprotein I in stroke in children.
20542541 2010 The plasma levels of activated thrombin activatable fibrinolysis inhibitor and thrombomodulin in Behçet disease and their association with thrombosis.
20538124 2010 Genetic polymorphisms and the cardiovascular risk of non-steroidal anti-inflammatory drugs.
20513133 2010 Mutations in alternative pathway complement proteins in American patients with atypical hemolytic uremic syndrome.
20505198 2010 Association of PDGF-BB-induced thrombomodulin with the regulation of inflammation in the corneal and scleral stroma.
20479117 2010 Characterization of human DNGR-1+ BDCA3+ leukocytes as putative equivalents of mouse CD8alpha+ dendritic cells.
20479116 2010 Human CD141+ (BDCA-3)+ dendritic cells (DCs) represent a unique myeloid DC subset that cross-presents necrotic cell antigens.
20479115 2010 Superior antigen cross-presentation and XCR1 expression define human CD11c+CD141+ cells as homologues of mouse CD8+ dendritic cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20309589 2012 Modulation of tissue factor and thrombomodulin expression in human aortic endothelial cells incubated with high glucose.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20128871 2010 Gene variants associated with venous thrombosis: confirmation in the MEGA study.
20116378 2010 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20051099 2010 Placental thrombomodulin expression in recurrent miscarriage.
20036902 2010 Hemostatic gene polymorphisms in young Sardinian with non-fatal acute myocardial infarction.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900089 2009 Thrombomodulin expression in gastrointestinal stromal tumours (GISTs): a novel finding with diagnostic implications.
19682239 2009 Replication of findings on the association of genetic variation in 24 hemostasis genes and risk of incident venous thrombosis.
19656282 2009 Molecular basis of thrombomodulin activation of slow thrombin.
19638712 2009 Increased P-selectin expression on platelets and decreased plasma thrombomodulin in Fontan patients.
19625716 2009 Thrombomodulin mutations in atypical hemolytic-uremic syndrome.
19609862 2009 Atorvastatin induces thrombomodulin expression in the aorta of cholesterol-fed rabbits and in TNFalpha-treated human aortic endothelial cells.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19477487 2009 Kynurenines and oxidative status are independently associated with thrombomodulin and von Willebrand factor levels in patients with end-stage renal disease.
19436051 2009 Valves of the deep venous system: an overlooked risk factor.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19356953 2009 Elevated tissue expression of thrombomodulatory factors correlates with acute symptomatic carotid plaque phenotype.
19278588 2009 [Effect of C5a on expression of thrombomodulin in endothelial cells in vitro].
19238444 2009 The genomic basis of cerebral palsy: a HuGE systematic literature review.
19133039 2008 The prevalence of inherited thrombophilic polymorphisms in an asymptomatic Australian antenatal population.
19091791 2009 Ets-1 mediates platelet-derived growth factor-BB-induced thrombomodulin expression in human vascular smooth muscle cells.
19074424 2009 The roles of selected arginine and lysine residues of TAFI (Pro-CPU) in its activation to TAFIa by the thrombin-thrombomodulin complex.
19055859 2008 Thrombomodulin and GFC levels in Legg-Calve-Perthes disease.
18991188 Clinical significance of nailfold capillaroscopy in systemic lupus erythematosus: correlation with endothelial cell activation markers and disease activity.
18977990 2008 Candidate genes and cerebral palsy: a population-based study.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18947863 2009 Allergen-enhanced thrombomodulin (blood dendritic cell antigen 3, CD141) expression on dendritic cells is associated with a TH2-skewed immune response.
18940182 2008 Thrombomodulin exerts cytoprotective effect on low-dose UVB-irradiated HaCaT cells.
18590927 2008 Impaired binding of thrombin to thrombomodulin is associated with risk of deep vein thrombosis.
18579691 2008 RNA-binding protein HuR interacts with thrombomodulin 5'untranslated region and represses internal ribosome entry site-mediated translation under IL-1 beta treatment.
18568955 Thrombin downregulates thrombomodulin expression and activity in primary human endothelial cells.
18484695 2008 Clinical significance of selected endothelial activation markers in patients with systemic lupus erythematosus.
18373234 2009 Decreased plasma soluble thrombomodulin levels as a risk factor for pulmonary thromboembolism.
18204921 2008 Thrombomodulin gene polymorphisms in brain infarction and mortality after stroke.
18035074 2007 Association of polymorphisms in platelet and hemostasis system genes with acute myocardial infarction.
17982464 2007 Activated protein C protects against diabetic nephropathy by inhibiting endothelial and podocyte apoptosis.
17895503 2008 Correlation between thrombomodulin and severe preeclampsia: a summary.
17875054 2007 Changes in circulating thrombomodulin levels with exercise in patients with chronic obstructive pulmonary disease.
17849052 2007 Thrombomodulin-mediated catabolism of protein C by pleural mesothelial and vascular endothelial cells.
17848551 2007 Thrombomodulin is a clock-controlled gene in vascular endothelial cells.
17702963 2007 An interactive association of common sequence variants in the neuropeptide Y gene with susceptibility to ischemic stroke.
17677000 2007 Combined effects of thrombosis pathway gene variants predict cardiovascular events.
17379830 2007 Protease nexin-1 interacts with thrombomodulin and modulates its anticoagulant effect.
17287633 2007 Lipopolysaccharide down-regulates the thrombomodulin expression of peripheral blood monocytes: effect of serum on thrombomodulin expression in the THP-1 monocytic cell line.
17278618 2006 Ethnic differences in the prevalence of inherited thrombophilic polymorphisms in an asymptomatic Australian prenatal population.
17275499 The expression of von Willebrand factor, soluble thrombomodulin, and soluble p-selectin during orthotopic liver transplantation.
17195062 2007 Soluble thrombomodulin as a predictor of type 2 diabetes: results from the MONICA/KORA Augsburg case-cohort study, 1984-1998.
17099210 2007 Variations in the thrombomodulin and endothelial protein C receptor genes in couples with recurrent miscarriage.
17099142 2007 Novel role of the human alveolar epithelium in regulating intra-alveolar coagulation.
17067436 Circulating thrombomodulin levels in familial Mediterranean fever.
17049585 2007 Endothelial protein C receptor plasma levels increase in chronic liver disease, while thrombomodulin plasma levels increase only in hepatocellular carcinoma.
17003923 2006 Gene polymorphisms implicated in influencing susceptibility to venous and arterial thromboembolism: frequency distribution in a healthy German population.
16507317 2007 Haplotype of thrombomodulin gene associated with plasma thrombomodulin level and deep vein thrombosis in the Japanese population.
16456088 2006 Thrombomodulin gene polymorphisms and haplotypes and the risk of cardiovascular events: a prospective follow-up study.
16418283 2006 Activation of protein C by the thrombin-thrombomodulin complex: cooperative roles of Arg-35 of thrombin and Arg-67 of protein C.
16307806 2006 Increasing post-event plasma thrombomodulin level associates with worse outcome in survival of acute coronary syndrome.
16153429 2005 C-reactive protein decreases expression of thrombomodulin and endothelial protein C receptor in human endothelial cells.
16136486 2005 Increased immunohistochemical expression of thrombomodulin at placental perivascular myofibroblast in severe preeclampsia (PE).
16126727 2005 Endothelial thrombomodulin induces Ca2+ signals and nitric oxide synthesis through epidermal growth factor receptor kinase and calmodulin kinase II.
16043642 2005 Kruppel-like factor 2 as a novel mediator of statin effects in endothelial cells.
15900300 2005 Analysis of differential gene expression in human melanocytic tumour lesions by custom made oligonucleotide arrays.
15897668 Markers of endothelial cell activation/injury: CD146 and thrombomodulin are related to adiponectin in kidney allograft recipients.
15842356 2005 Thrombomodulin gene polymorphisms or haplotypes as potential risk factors for venous thromboembolism: a population-based case-control study.
15837080 2005 Association study of the thrombomodulin -33G>A polymorphism with coronary artery disease and myocardial infarction in Chinese Han population.
15714116 2005 Silencing of the thrombomodulin gene in human malignant melanoma.
15705565 2005 The affinity of protein C for the thrombin.thrombomodulin complex is determined in a primary way by active site-dependent interactions.
15677570 2005 Regulation of endothelial thrombomodulin expression by inflammatory cytokines is mediated by activation of nuclear factor-kappa B.
15613027 2004 The profibrinolytic effect of plasma thrombomodulin in factor XI deficiency and its implications in hemostasis.
15582990 2005 Thrombomodulin changes the molecular surface of interaction and the rate of complex formation between thrombin and protein C.
15574195 2004 Thrombomodulin Ala455Val Polymorphism and the risk of cerebral infarction in a biracial population: the Stroke Prevention in Young Women Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488871 2004 A combination of two common thrombomodulin gene variants (-1208-1209TTdelTT and A455V) influence risk of coronary heart disease: a prospective study in men.
15183044 2004 Genetic variation in the human thrombomodulin promoter locus and prognosis after acute coronary syndrome.
15178554 2004 Thrombomodulin-protein C-EPCR system: integrated to regulate coagulation and inflammation.
15135268 2004 Genetic risk for restenosis after coronary balloon angioplasty.
15099291 2004 Thrombomodulin expression on Langerhans' islet: can endogenous 'anticoagulant on demand' overcome detrimental thrombotic complications in clinical islet transplantation?
15080580 2004 Expression of endothelial protein C receptor and thrombomodulin in human coronary atherosclerotic plaques.
14987915 2003 Soluble P-selectin and thrombomodulin-protein C-Protein S pathway in cyanotic congenital heart disease with secondary erythrocytosis.
14983241 2004 Common variants in the thrombomodulin gene as a risk for myocardial infarction in the north of Europe (HIFMECH Study).
14769148 2003 Thrombomodulin RNA is destabilized through its 3'-untranslated element in cells exposed to IFN-gamma.
14715348 2004 Relation of thrombomodulin gene polymorphisms to acute myocardial infarction in patients <or =50 years of age.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691232 2004 Two different proteins that compete for binding to thrombin have opposite kinetic and thermodynamic profiles.
14556624 2003 NMR structures reveal how oxidation inactivates thrombomodulin.
14523329 2003 Haemostatic gene polymorphisms in young indian asian subjects with acute myocardial infarction.
12951323 2003 Thrombomodulin-mediated cell adhesion: involvement of its lectin-like domain.
12920633 2003 Decrease of thrombomodulin contributes to the procoagulant state of endothelium in hemolytic uremic syndrome.
12918732 2003 Behçet's disease with vascular involvement: the contribution of anticardiolipin antibodies and thrombomodulin.
12878585 2003 Thrombomodulin enhances the reactivity of thrombin with protein C inhibitor by providing both a binding site for the serpin and allosterically modulating the activity of thrombin.
12871600 2003 Genetic risk factors for cerebrovascular disease in children with sickle cell disease: design of a case-control association study and genomewide screen.
12871544 2003 Prospective study of the A455V polymorphism in the thrombomodulin gene, plasma thrombomodulin, and incidence of venous thromboembolism: the LITE Study.
12862205 2003 Circulating thrombomodulin levels are related to latent progression of atherosclerosis in hypertensive patients.
12831611 2003 [Immunohistochemical study of thrombomodulin expression in multiple organs dysfunction syndrome].
12709053 2003 A steady-state competition model describes the modulating effects of thrombomodulin on thrombin inhibition by plasminogen activator inhibitor-1 in the absence and presence of vitronectin.
12588872 2003 Mutations in autolytic loop-2 and at Asp554 of human prothrombin that enhance protein C activation by meizothrombin.
12576329 2003 Oxidized phospholipids in oxidized low-density lipoprotein down-regulate thrombomodulin transcription in vascular endothelial cells through a decrease in the binding of RARbeta-RXRalpha heterodimers and Sp1 and Sp3 to their binding sequences in the TM promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12407115 2002 Modulation of thrombomodulin-dependent activation of human protein C through differential expression of endothelial Smads.
12297717 2002 Thrombomodulin Ala455Val dimorphism is not associated with pre-eclampsia in Australian and New Zealand women.
12210386 2002 Reduced thrombomodulin in human peripheral nerve microvasculature.
12204814 2002 Characterization of thrombomodulin gene mutations of the 5'-regulatory region.
12139752 2002 Mutations in the thrombomodulin gene are rare in patients with severe thrombophilia.
12135317 2002 Association of G-33A polymorphism in the thrombomodulin gene with myocardial infarction in Koreans.
12068020 2002 The thrombin epitope recognizing thrombomodulin is a highly cooperative hot spot in exosite I.
12066950 2002 Polymorphisms in various coagulation genes in black South African women with placental abruption.
11864708 2002 Decrease of fibrinolytic activity in human endothelial cells by arsenite.
11864703 2002 Increased levels of endothelial haemostatic markers in patients with coronary heart disease.
11858479 2002 Prospective study on soluble thrombomodulin and von Willebrand factor and the risk of ischemic and hemorrhagic stroke.
11848462 2002 Synergistic effect of thrombomodulin promoter -33G/A polymorphism and smoking on the onset of acute myocardial infarction.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11734675 2001 Association between decreased pulmonary endothelial cell thrombomodulin and local fibrin deposition in pneumonia.
11642722 2001 Thrombomodulin, calretinin and c-kit (CD117) expression in cardiac myxoma.
11552992 2001 Mutations in the thrombomodulin and endothelial protein C receptor genes in women with late fetal loss.
11257274 2001 Functional mutation in the promoter region of thrombomodulin gene in relation to carotid atherosclerosis.
11245641 2001 Thrombomodulin Ala455Val polymorphism and risk of coronary heart disease.
11231927 2001 Thrombomodulin promoter mutations, venous thrombosis, and varicose veins.
11106601 2000 Modeling zymogen protein C.
10336638 1999 The interaction of thrombomodulin with Ca2+.
10066849 1999 Brain-specific protein C activation during carotid artery occlusion in humans.
9843165 1998 A mutation in the thrombomodulin gene, 127G to A coding for Ala25Thr, and the risk of myocardial infarction in men.
9395524 1997 Platelet factor 4 binds to glycanated forms of thrombomodulin and to protein C. A potential mechanism for enhancing generation of activated protein C.
9367781 1997 Structure of the fifth EGF-like domain of thrombomodulin: An EGF-like domain with a novel disulfide-bonding pattern.
9252393 1997 Increased tissue factor-initiated prothrombin activation as a result of the Arg506 --> Gln mutation in factor VLEIDEN.
9198186 1997 Thrombomodulin gene variations and thromboembolic disease.
9157575 1997 A common thrombomodulin amino acid dimorphism is associated with myocardial infarction.
9045633 1997 Functional characterization of recombinant human meizothrombin and Meizothrombin(desF1). Thrombomodulin-dependent activation of protein C and thrombin-activatable fibrinolysis inhibitor (TAFI), platelet aggregation, antithrombin-III inhibition.
8745396 1996 Structural resiliency of an EGF-like subdomain bound to its target protein, thrombin.
8663147 1996 TAFI, or plasma procarboxypeptidase B, couples the coagulation and fibrinolytic cascades through the thrombin-thrombomodulin complex.
8661740 1996 Radiation hybrid mapping of SNAP, PCSK2, and THBD (human chromosome 20p).
8528067 1995 Synthesis, activity, and preliminary structure of the fourth EGF-like domain of thrombomodulin.
8390446 1993 Urinary thrombomodulin, its isolation and characterization.
8244401 1993 Human somatostatin receptor genes: localization of SSTR5 to human chromosome 20p11.2.
8216207 1993 Identification of the predominant glycosaminoglycan-attachment site in soluble recombinant human thrombomodulin: potential regulation of functionality by glycosyltransferase competition for serine474.
7947766 1994 Thrombin-bound structure of an EGF subdomain from human thrombomodulin determined by transferred nuclear Overhauser effects.
7811989 1995 The first mutation identified in the thrombomodulin gene in a 45-year-old man presenting with thromboembolic disease.
7615164 1995 Thrombomodulin as a model of molecular mechanisms that modulate protease specificity and function at the vessel surface.
7559494 1995 The structure of a 19-residue fragment from the C-loop of the fourth epidermal growth factor-like domain of thrombomodulin.
3001144 1985 Thrombomodulin is present in human plasma and urine.
2839283 1988 Immunohistochemical localization of thrombomodulin in chorionic diseases of the uterus and choriocarcinoma of the stomach. A comparative study with the distribution of human chorionic gonadotropin.
2836377 1988 Gene structure of human thrombomodulin, a cofactor for thrombin-catalyzed activation of protein C.
2822087 1987 Human thrombomodulin: complete cDNA sequence and chromosome localization of the gene.
2820710 1987 Structure and expression of human thrombomodulin, a thrombin receptor on endothelium acting as a cofactor for protein C activation.
2819876 1987 Human thrombomodulin gene is intron depleted: nucleic acid sequences of the cDNA and gene predict protein structure and suggest sites of regulatory control.
2544585 1989 Macromolecular specificity determinants on thrombin for fibrinogen and thrombomodulin.
2538457 1989 The roles of protein C and thrombomodulin in the regulation of blood coagulation.
1667949 1991 Thrombomodulin in the central nervous system.