Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.90
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 1.0e-03
osteosarcoma 7950 2.6e-03
progressive supranuclear palsy 676 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.044 2.6e-03
Pick disease -1.200 1.0e-03
progressive supranuclear palsy -1.300 1.7e-02

Gene RIF (1)

AA Sequence

MTRSCSAVGCSTRDTVLSRERGLSFHQFPTDTIQRSKWIRAVNRVDPRSKKIWIPGPGAILCSKHFQESD      1 - 70
FESYGIRRKLKKGAVPSVSLYKIPQGVHLKGKARQKILKQPLPDNSQEVATEDHNYSLKTPLTIGAEKLA     71 - 140
EVQQMLQVSKKRLISVKNYRMIKKRKGLRLIDALVEEKLLSEETECLLRAQFSDFKWELYNWRETDEYSA    141 - 210
EMKQFACTLYLCSSKVYDYVRKILKLPHSSILRTWLSKCQPSPGFNSNIFSFLQRRVENGDQLYQYCSLL    211 - 280
IKSMPLKQQLQWDPSSHSLQGFMDFGLGKLDADETPLASETVLLMAVGIFGHWRTPLGYFFVNRASGYLQ    281 - 350
AQLLRLTIGKLSDIGITVLAVTSDATAHSVQMAKALGIHIDGDDMKCTFQHPSSSSQQIAYFFDSCHLLR    351 - 420
LIRNAFQNFQSIQFINGIAHWQHLVELVALEEQELSNMERIPSTLANLKNHVLKVNSATQLFSESVASAL    421 - 490
EYLLSLDLPPFQNCIGTIHFLRLINNLFDIFNSRNCYGKGLKGPLLPETYSKINHVLIEAKTIFVTLSDT    491 - 560
SNNQIIKGKQKLGFLGFLLNAESLKWLYQNYVFPKVMPFPYLLTYKFSHDHLELFLKMLRQVLVTSSSPT    561 - 630
CMAFQKAYYNLETRYKFQDEVFLSKVSIFDISIARRKDLALWTVQRQYGVSVTKTVFHEEGICQDWSHCS    631 - 700
LSEALLDLSDHRRNLICYAGYVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSESLCR    701 - 770
VINICERVVRTHSRMAIFELVSKQRELYLQQKILCELSGHINLFVDVNKHLFDGEVCAINHFVKLLKDII    771 - 840
ICFLNIRAKNVAQNPLKHHSERTDMKTLSRKHWSSVQDYKCSSFANTSSKFRHLLSNDGYPFK           841 - 903
//

Text Mined References (8)

PMID Year Title