THAP domain-containing protein 8

Property Summary

NCBI Gene PubMed Count	6
PubMed Score	0.00

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Testis 18,518

Colon - Sigmoid 18,089

Nerve - Tibial 18,007

Esophagus - Muscularis 18,017

Esophagus - Gastroesophageal Junction 18,000

Brain - Spinal cord (cervical c-1) 17,973

Ovary 17,971

Uterus 17,618

Vagina 17,834

Brain - Cerebellar Hemisphere 18,015

Cells - Transformed fibroblasts 17,577

Brain - Cerebellum 17,983

Skin - Not Sun Exposed (Suprapubic) 18,081

Artery - Tibial 17,631

Pituitary 18,147

Brain - Substantia nigra 17,981

Artery - Coronary 17,949

Prostate 18,213

Brain - Hypothalamus 18,169

Spleen 17,614

Adipose - Visceral (Omentum) 17,937

Brain - Frontal Cortex (BA9) 18,069

Artery - Aorta 17,896

Cells - EBV-transformed lymphocytes 18,186

Skin - Sun Exposed (Lower leg) 17,968

Brain - Cortex 18,039

Esophagus - Mucosa 18,076

Brain - Amygdala 18,006

Brain - Anterior cingulate cortex (BA24) 17,989

Thyroid 18,024

Adipose - Subcutaneous 18,110

Stomach 17,879

Brain - Hippocampus 18,011

Adrenal Gland 18,071

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Caudate (basal ganglia) 18,001

Breast - Mammary Tissue 18,103

Brain - Putamen (basal ganglia) 17,863

Muscle - Skeletal 17,778

Kidney - Cortex 17,329

Small Intestine - Terminal Ileum 17,954

Heart - Atrial Appendage 17,896

Minor Salivary Gland 18,005

Liver 18,071

Whole Blood 17,439

Heart - Left Ventricle 18,006

Colon - Transverse 17,825

Lung 18,057

Pancreas 18,123

Adult Liver 9,113

Adult Frontal Cortex 9,048

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Skin 1,556

Testis 3,897

Uterus 1,493

See source...

See source...

Synonym

Accession	Q8NA92 Q0P5Z7 Q96M21
Symbols

Gene

THAP8

Ortholog (3)

Species	Source	Disease
Dog 15,073	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Macaque 12,761	Inparanoid OMA

UniProt Keyword (7)

Complete proteome 20,231

DNA-binding 2,008

Metal-binding 3,672

Polymorphism 12,194

Reference proteome 20,231

Zinc 2,356

Zinc-finger 1,785

GO Function (2)

DNA binding 1,481

metal ion binding 2,256

Compartment GO Term (2)

Nucleoplasm 5,077

cellular_component 18,320

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Protein-protein Interaction (4)

UBE2D2 LASP1 PRMT7 C9orf16

AA Sequence

MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPSCFQWR      1 - 70
WGVRYLRPDAVPSIFSRGPPAKSQRRTRSTQKPVSPPPPLQKNTPLPQSPAIPVSGPVRLVVLGPTSGSP     71 - 140
KTVATMLLTPLAPAPTPERSQPEVPAQQAQTGLGPVLGALQRRVRRLQRCQERHQAQLQALERLAQQLHG    141 - 210
ESLLARARRGLQRLTTAQTLGPEESQTFTIICGGPDIAMVLAQDPAPATVDAKPELLDTRIPSA          211 - 274
//

Text Mined References (6)

Summary
Details

	PMID	Year	Title