Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.23
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0

Expression

Gene RIF (1)

AA Sequence

MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKEWVLNIGRGNFKPKQHTVICSEHFRPECFSAFGNR      1 - 70
KNLKHNAVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKVLPEAGAGEDSPGRNMDTALEELQLPPNA     71 - 140
EGHVKQVSPRRPQATEAVGRPTGPAGLRRTPNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQR    141 - 210
LVMRRMSSRLRACKGHQGLQARLGPEQQS                                             211 - 239
//

Text Mined References (8)

PMID Year Title