Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.83
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.100 7.6e-03
hepatocellular carcinoma 1.200 4.1e-04
osteosarcoma -1.096 3.1e-03
group 4 medulloblastoma 1.800 1.7e-04
adrenocortical carcinoma -3.720 7.2e-09
tuberculosis -1.900 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.100 8.6e-03
sarcoidosis 1.200 4.6e-03
nasopharyngeal carcinoma 1.200 8.8e-03
psoriasis 1.500 8.3e-14
spina bifida -1.916 3.6e-02

Synonym

Accession Q9H0W7 B2R8P3
Symbols

Gene

PANTHER Protein Class (1)

PDB

2D8R  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRR      1 - 70
LKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIK     71 - 140
LEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQ    141 - 210
QDKTLLSLNLKQTKSTFI                                                        211 - 228
//

Text Mined References (12)

PMID Year Title
22566634 2012 The genetic architecture of economic and political preferences.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.