Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.07
PubTator Score 19.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.6e-06
Breast cancer 3098 3.4e-02

Gene RIF (8)

PMID Text
25437553 THAP11, ZNF143, and HCF-1 form a mutually dependent complex on chromatin, which is independent of E2F occupancy.
24637716 that THAP11 reversibly regulated erythroid and megakaryocytic differentiation.
23539139 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
22673507 In HCC patients, the expression of THAP11 mRNA significantly correlated with PCBP1 mRNA expression. Our results suggest a novel role of THAP11 in CD44 alternative splicing and hepatoma invasion
22371484 identify THAP11 as a transcriptional regulator differentially expressed in human colon cancer
21400515 the induced THAP11 might be one of transcriptional regulators of c-Myc expression in CML cell.
19008924 Results suggest that THAP11 functions as a cell growth suppressor by negatively regulating the expression of c-Myc.
18976975 Knockdown of THAP domain containing 11 (THAP11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRK      1 - 70
TYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTA     71 - 140
QTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASE    141 - 210
LQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKG    211 - 280
SIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM                                        281 - 314
//

Text Mined References (20)

PMID Year Title
25437553 2014 Host cell factor-1 recruitment to E2F-bound and cell-cycle-control genes is mediated by THAP11 and ZNF143.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24637716 2014 Effects of THAP11 on erythroid differentiation and megakaryocytic differentiation of K562 cells.
23539139 2013 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23306615 2013 NMR studies of a new family of DNA binding proteins: the THAP proteins.
22673507 2012 THAP11, a novel binding protein of PCBP1, negatively regulates CD44 alternative splicing and cell invasion in a human hepatoma cell line.
22371484 2012 A transcriptional regulatory role of the THAP11-HCF-1 complex in colon cancer cell function.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21400515 2012 Down-regulation of Thanatos-associated protein 11 by BCR-ABL promotes CML cell proliferation through c-Myc expression.
19008924 2009 Cell growth suppression by thanatos-associated protein 11(THAP11) is mediated by transcriptional downregulation of c-Myc.
18585351 2008 Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368101 2004 SMARCA2 and THAP11: potential candidates for polyglutamine disorders as evidenced from polymorphism and protein-folding simulation studies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.
8325628 1993 Novel triplet repeat containing genes in human brain: cloning, expression, and length polymorphisms.