| Tbio | THAP domain-containing protein 11 |
Transcriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. Sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers (By similarity).
The protein encoded by this gene contains a THAP domain, which is a conserved DNA-binding domain that has striking similarity to the site-specific DNA-binding domain (DBD) of Drosophila P element transposases. [provided by RefSeq, Jul 2008]
The protein encoded by this gene contains a THAP domain, which is a conserved DNA-binding domain that has striking similarity to the site-specific DNA-binding domain (DBD) of Drosophila P element transposases. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| malignant mesothelioma | 3163 | 1.6e-06 |
| Breast cancer | 3098 | 3.4e-02 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | 1.100 | 1.6e-06 |
| Breast cancer | 2.400 | 3.4e-02 |
| PMID | Text | |
|---|---|---|
| 25437553 | THAP11, ZNF143, and HCF-1 form a mutually dependent complex on chromatin, which is independent of E2F occupancy. | |
| 24637716 | that THAP11 reversibly regulated erythroid and megakaryocytic differentiation. | |
| 23539139 | HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy. | |
| 22673507 | In HCC patients, the expression of THAP11 mRNA significantly correlated with PCBP1 mRNA expression. Our results suggest a novel role of THAP11 in CD44 alternative splicing and hepatoma invasion | |
| 22371484 | identify THAP11 as a transcriptional regulator differentially expressed in human colon cancer | |
| 21400515 | the induced THAP11 might be one of transcriptional regulators of c-Myc expression in CML cell. | |
| 19008924 | Results suggest that THAP11 functions as a cell growth suppressor by negatively regulating the expression of c-Myc. | |
| 18976975 | Knockdown of THAP domain containing 11 (THAP11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells |
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRK 1 - 70 TYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTA 71 - 140 QTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASE 141 - 210 LQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKG 211 - 280 SIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM 281 - 314 //
| PMID | Year | Title | |
|---|---|---|---|
| 25437553 | 2014 | Host cell factor-1 recruitment to E2F-bound and cell-cycle-control genes is mediated by THAP11 and ZNF143. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 25056061 | 2014 | Biological insights from 108 schizophrenia-associated genetic loci. | |
| 24637716 | 2014 | Effects of THAP11 on erythroid differentiation and megakaryocytic differentiation of K562 cells. | |
| 23539139 | 2013 | HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy. | |
| 23306615 | 2013 | NMR studies of a new family of DNA binding proteins: the THAP proteins. | |
| 22673507 | 2012 | THAP11, a novel binding protein of PCBP1, negatively regulates CD44 alternative splicing and cell invasion in a human hepatoma cell line. | |
| 22371484 | 2012 | A transcriptional regulatory role of the THAP11-HCF-1 complex in colon cancer cell function. | |
| 21988832 | 2011 | Toward an understanding of the protein interaction network of the human liver. | |
| 21400515 | 2012 | Down-regulation of Thanatos-associated protein 11 by BCR-ABL promotes CML cell proliferation through c-Myc expression. | |
| 19008924 | 2009 | Cell growth suppression by thanatos-associated protein 11(THAP11) is mediated by transcriptional downregulation of c-Myc. | |
| 18585351 | 2008 | Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15368101 | 2004 | SMARCA2 and THAP11: potential candidates for polyglutamine disorders as evidenced from polymorphism and protein-folding simulation studies. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12575992 | 2003 | The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 9853615 | 1998 | Selection system for genes encoding nuclear-targeted proteins. | |
| 8325628 | 1993 | Novel triplet repeat containing genes in human brain: cloning, expression, and length polymorphisms. |
