Property Summary

NCBI Gene PubMed Count 34
PubMed Score 24.43
PubTator Score 16.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.900 3.7e-07
psoriasis -1.300 3.8e-04
osteosarcoma 1.180 1.1e-02
glioblastoma 1.600 4.8e-06
group 3 medulloblastoma 1.400 3.5e-02
atypical teratoid / rhabdoid tumor 1.900 6.2e-10
medulloblastoma, large-cell 1.500 2.0e-05
primitive neuroectodermal tumor 1.700 1.8e-04
intraductal papillary-mucinous carcinoma... 1.200 5.5e-03
diabetes mellitus -1.200 4.0e-03
Breast cancer 2.900 2.4e-02
pediatric high grade glioma 1.300 1.2e-06
pilocytic astrocytoma 1.300 4.5e-08
ovarian cancer 1.900 2.4e-05

Protein-protein Interaction (3)

Gene RIF (19)

PMID Text
26738492 Data highlight the importance of the catalytic activity of PIMT to mediate VEGF effects during endothelial cell migration and tube formation in angiogenesis.
26074133 Self-association of Tgs1p and its catalytic activity were prerequisite to bypass the requirement for its accessory factor Swm2p for efficient pre-rRNA processing and snRNA trimethylation.
24330569 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
23922881 PIMT was identified as a key player responsible for glycated low density lipoproteins induced vascular endothelial cell apoptosis.
23754689 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
21358275 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
21204776 The protein L-isoaspartyl (D-aspartyl) methyltransferase (PIMT) is an enzyme that recognizes and repairs the abnormal L-isoaspartyl residues in proteins.
20679221 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360394 The structure-function data highlight a strictly essential pi-cation interaction between Trp766 and the m(7)G base and a network of important enzymic contacts to the cap triphosphate via Lys646, Tyr771, Arg807, and Lys836.
19386620 The crystal structure of the substrate bound methyltransferase domain as well as mutagenesis studies provide insight into the catalytic mechanism of TGS1.
19307714 m(7)GpppA binds via its adenosine moiety to the structurally conserved adenosylmethionine-binding pocket. The m(7) guanosine is unbound. The crystallized TGS1 fragment is catalytically inactive, but a fragment that is 17 AAs longer exhibits activity.
18775984 present a biochemical characterization of the human Tgs1 guanine-N2 methyltransferase reaction and identify individual amino acids required for methyltransferase activity in vitro and in vivo
18660489 Observational study of gene-disease association. (HuGE Navigator)
18407833 These results highlight that PIMT expression is regulated by ROS and could primarily act as an antioxidant enzyme.
18039666 proteasome maturation constitutes a mechanism regulating Tgs1 function by generating Tgs1 species with different substrate specificities, subcellular localizations, and functions.
12943661 isoforms of the PIMT/Tgs1 protein with an RNA methyltransferase domain function both in the nucleus and in the cytoplasm
11912212 Interaction of PIMT with transcriptional coactivators CBP, p300, and PBP differential role in transcriptional regulation.

AA Sequence

MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQATEEEEGGYSCG      1 - 70
TAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQE     71 - 140
SWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEKYWNEYGGGLL    141 - 210
WQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEAD    211 - 280
DKNDEKCMKVDLVSFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSE    281 - 350
VSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHK    351 - 420
PSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKM    421 - 490
KNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSEEQDMSVKKGD    491 - 560
DLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQDCVTQEVPDSRQAETEAEVKKKKNKKKNKK    561 - 630
VNGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCG    631 - 700
VGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPD    701 - 770
YATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITA    771 - 840
YFGDLIRRPASET                                                             841 - 853
//

Text Mined References (41)

PMID Year Title
26738492 2016 The enzyme L-isoaspartyl (D-aspartyl) methyltransferase is required for VEGF-dependent endothelial cell migration and tubulogenesis.
26074133 2015 Self-association of Trimethylguanosine Synthase Tgs1 is required for efficient snRNA/snoRNA trimethylation and pre-rRNA processing.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
23922881 2013 PIMT prevents the apoptosis of endothelial cells in response to glycated low density lipoproteins and protective effects of grape seed procyanidin B2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21522132 2011 CRM1 controls the composition of nucleoplasmic pre-snoRNA complexes to licence them for nucleolar transport.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21204776 2011 Damaged proteins bearing L-isoaspartyl residues and aging: a dynamic equilibrium between generation of isomerized forms and repair by PIMT.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360394 2010 Mutational analyses of trimethylguanosine synthase (Tgs1) and Mud2: proteins implicated in pre-mRNA splicing.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386620 2009 Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1.
19307714 2009 Structure analysis of the conserved methyltransferase domain of human trimethylguanosine synthase TGS1.
18775984 2008 Genetic and biochemical analysis of yeast and human cap trimethylguanosine synthase: functional overlap of 2,2,7-trimethylguanosine caps, small nuclear ribonucleoprotein components, pre-mRNA splicing factors, and RNA decay pathways.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18407833 2008 Reactive oxygen species generated by thiol-modifying phenylarsine oxide stimulate the expression of protein L-isoaspartyl methyltransferase.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18039666 2008 Characterization of a short isoform of human Tgs1 hypermethylase associating with small nucleolar ribonucleoprotein core proteins and produced by limited proteolytic processing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16687569 2006 Ongoing U snRNP biogenesis is required for the integrity of Cajal bodies.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12943661 2003 Different isoforms of PRIP-interacting protein with methyltransferase domain/trimethylguanosine synthase localizes to the cytoplasm and nucleus.
12776181 2003 Interaction between the small-nuclear-RNA cap hypermethylase and the spinal muscular atrophy protein, survival of motor neuron.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200376 2002 Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.
12189208 2002 Identification of a transcriptionally active peroxisome proliferator-activated receptor alpha -interacting cofactor complex in rat liver and characterization of PRIC285 as a coactivator.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
12032086 2002 Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments.
11983179 2002 Hypermethylation of the cap structure of both yeast snRNAs and snoRNAs requires a conserved methyltransferase that is localized to the nucleolus.
11912212 2002 Interaction of PIMT with transcriptional coactivators CBP, p300, and PBP differential role in transcriptional regulation.
11517327 2001 Cloning and characterization of PIMT, a protein with a methyltransferase domain, which interacts with and enhances nuclear receptor coactivator PRIP function.