Property Summary

NCBI Gene PubMed Count 25
PubMed Score 106.17
PubTator Score 90.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.200 2.0e-02
Multiple myeloma 1.113 2.2e-02
esophageal adenocarcinoma 1.400 2.5e-02
psoriasis 1.500 7.1e-05
astrocytoma 1.300 2.6e-02
atypical teratoid / rhabdoid tumor 1.100 4.7e-06
glioblastoma 1.300 3.1e-03
medulloblastoma, large-cell -1.500 5.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.040 9.1e-03
intraductal papillary-mucinous adenoma (... 1.500 6.3e-03
intraductal papillary-mucinous carcinoma... 1.500 1.1e-02
lung cancer -1.200 3.6e-02
acute myeloid leukemia 1.600 2.2e-03
ovarian cancer 2.400 2.8e-06

 GWAS Trait (1)

Gene RIF (11)

PMID Text
24910430 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
24221250 These results indicate that hepatitis E virus (HEV)forms membrane-associated particles in the cytoplasm, and that the released HEV particles with a lipid membrane retain the antigenicity of TGOLN2 on their surface.
21900423 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
21607084 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
21563830 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
20926557 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
20468057 These analyses do not provide support for the hypothesis that common genetic variation in TGOLN2 contributes significantly to the risk for attempted suicide in subjects with major mood disorders.
20468057 Observational study of gene-disease association. (HuGE Navigator)
20386718 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
20138391 These data have identified different itineraries for the retrograde transport of Shiga toxin and TGN38 and distinct retromer components that regulate the transport of these cargos.
20086247 FXIII-A associated with podosomes & other structures adjacent to the plasma membrane, containing TGN46 & GM130 but not protein disulphide isomerase. FXIII-A was present in GM130-positive intracellular vesicles that could mediate its transport.

AA Sequence

MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKS      1 - 70
SAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKS     71 - 140
GAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKS    141 - 210
GAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADT    211 - 280
NQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSA    281 - 350
SSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK    351 - 420
VTRRPKASDYQRLDQKYVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL              421 - 480
//

Text Mined References (38)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24221250 2014 The membrane on the surface of hepatitis E virus particles is derived from the intracellular membrane and contains trans-Golgi network protein 2.
23386608 2013 Dynamics of the rhomboid-like protein RHBDD2 expression in mouse retina and involvement of its human ortholog in retinitis pigmentosa.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
21994457 2011 VPg-primed RNA synthesis of norovirus RNA-dependent RNA polymerases by using a novel cell-based assay.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20468057 2010 Case-control association study of TGOLN2 in attempted suicide.
20138391 2010 Identification of different itineraries and retromer components for endosome-to-Golgi transport of TGN38 and Shiga toxin.
20086247 2010 Association of coagulation factor XIII-A with Golgi proteins within monocyte-macrophages: implications for subcellular trafficking and secretion.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18166528 2008 SLC24A5 encodes a trans-Golgi network protein with potassium-dependent sodium-calcium exchange activity that regulates human epidermal melanogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15916959 2005 Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14743217 2004 Protein kinase D regulates basolateral membrane protein exit from trans-Golgi network.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
11208159 2000 The luminal domain of TGN38 interacts with integrin beta 1 and is involved in its trafficking.
10514494 1999 Direct interaction of the trans-Golgi network membrane protein, TGN38, with the F-actin binding protein, neurabin.
9794796 1998 Specificity of interaction between adaptor-complex medium chains and the tyrosine-based sorting motifs of TGN38 and lgp120.
9422759 1998 Molecular cloning and expression of a novel human trans-Golgi network glycoprotein, TGN51, that contains multiple tyrosine-containing motifs.
8907712 1996 Primate homologues of rat TGN38: primary structure, expression and functional implications.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7569928 1995 Interaction of tyrosine-based sorting signals with clathrin-associated proteins.