Property Summary

NCBI Gene PubMed Count 330
PubMed Score 1478.32
PubTator Score 1720.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.100 7.4e-07
cutaneous lupus erythematosus 2.600 3.1e-04
osteosarcoma -1.681 3.1e-02
cystic fibrosis 2.088 1.1e-06
group 4 medulloblastoma -1.500 9.7e-04
medulloblastoma, large-cell -1.500 2.1e-03
primary pancreatic ductal adenocarcinoma 2.087 3.5e-04
non-small cell lung cancer -1.447 6.2e-10
intraductal papillary-mucinous adenoma (... -3.100 9.6e-05
intraductal papillary-mucinous carcinoma... -2.100 1.3e-02
lung cancer -3.900 9.4e-07
ulcerative colitis 3.300 4.4e-10
pancreatic cancer 2.300 5.8e-05
interstitial cystitis 1.600 1.1e-03
atypical teratoid/rhabdoid tumor -1.100 8.0e-04
lung adenocarcinoma -1.700 5.2e-07
COPD -1.500 2.7e-03
lung carcinoma -3.400 7.0e-41
Breast cancer 1.400 3.1e-06
pterygium -1.300 1.2e-02
mucosa-associated lymphoid tissue lympho... 1.878 1.2e-02
invasive ductal carcinoma 1.600 5.5e-03
ovarian cancer 1.500 5.4e-03
pituitary cancer -2.700 3.8e-09

Gene RIF (287)

PMID Text
26702927 PKM2/TG2 interplay plays an important role in the regulation of autophagy in particular under cellular stressful conditions such as those displayed by cancer cells.
26542019 A gain-of-function mutation in P2X7R associated with autoimmune disease caused enhanced TG2 externalization from cells, and this correlated with increased pore activity.
26307914 Results show no genetic association of the TGM2 gene with schizophrenia in the Chinese cohort.
26250429 W332F mutation led to significant changes of both the Km and the Vmax kinetic parameters of the isopeptidase reaction of TG2 while its calcium and GTP sensitivity was similar to the wild-type enzyme.
26244572 Data show that transglutaminase 2 (TG2)-mediated self-crosslinking sites locate to the catalytic core and C-terminal part of TG2.
26184652 The differences in epitope specificity and subclass usage of IgG anti-tTG observed between celiac disease (CD) and non-CD individuals may be due to the differing mechanisms underlying tTG autoimmunity.
26160175 This work presents a study on the interaction between TG2 and an anti-TG2 antibody (679-14-E06) derived from a single gut IgA plasma cell of a celiac disease patient.
26153762 The frequency of TG2-specific plasma cells in the celiac lesion is dynamically regulated in response to gluten exposure.
26133787 We showed the appearance of transglutaminase (TG2) immunoreactivity in leukocytes in multiple sclerosis lesions, and particular in macrophages in rat chronic-relapsing experimental autoimmune encephalomyelitis.
26133738 Transglutaminase 2 up-regulation is associated with RANKL/OPG pathway
26041746 TG2 secreted in the tumor microenvironment orchestrates the cross-talk between cancer cells and stroma fundamentally affecting tumor growth.
25934693 miR-19 overexpression and subsequent decreased TG2 expression was linked to chromosome-13 amplification events, leading to altered invasive behavior in colorectal cancer cells.
25934691 TG2 has an important role in maintaining cancer stem cell survival, invasive, and metastatic behavior in epidermal squamous cell carcinoma.
25808416 In addition to fibronectin, collagen VI is a widely distributed interaction partner of TG2 in the extracellular matrix.
25547897 TG2 plays a key role in homocysteine-induced activation of THP-1 monocytes, involving oxidative as well as endoplasmic reticulum stress and inflammation.
25449226 define a role for TG2 activity at the surface of human macrophages in multiple stages of AC clearance and we propose that TG2, in association with heparan sulphates, may exert its effect on AC clearance via a mechanism involving the crosslinking of CD44
25419572 Data indicate Gln34, Gln42, Gln193 and Gln248 as the major transglutaminase 2 (TG2 reactive glutamines in osteopontin (OPN).
25404341 Data indicate that binding of transglutaminase 2 (TG2) by autoantibodies can induce structural changes, and mapping of the targeted epitopes suggests a possible mechanism for the induction of the autoimmune response.
25398223 Increases of TG2 protein expression and enzyme activity occur in astroglial, microglial and monocyte cell models in response to inflammatory stimuli.[review]
25247996 TGM2 expression increases as a function of malignancy grade and tumor recurrence and that inhibition of TGM2 reduces meningioma cell growth.
25243117 3 biomarkers in 44 patients with in situ breast cancers were evaluated: TG2 (transglutaminase 2), HJURP (Holliday junction recognition protein), and HIF-1alpha (hypoxia inducible factor-1 alpha).
25215932 our results show, for the first time, that eEF-2K is involved in regulation of the invasive phenotype of PaCa cells through promoting a new signalling pathway, which is mediated by TG2/b1 integrin/Src/uPAR/MMP-2
25209703 the sub-cellular localization of TG2, was investigated.
25201980 a pleiotropic enzyme transglutaminase type 2 targets the allosteric coupling domain of IP3R type 1 (IP3R1) and negatively regulates IP3R1-mediated calcium signaling and autophagy by locking the subunit configurations.
25192068 Sequence comparison provided information describing the evolutionary scenario of GTP usage for controlling the activity of TG2.
25131137 The objective of this study was to further investigate the presence of tTG-specific T cells in patients with treated and untreated CD, and normal controls.
25060553 Data presented in this study show that TG2 plays a key role in cellular dynamics and consequently influences the energetic metabolism.
25015117 High gamma-glutamyltransferase is associated with impaired fasting glucose in obese patients.
24885370 IgA-anti-TG1 antibodies were found in 2% and IgA-anti-TG3 antibodies in 3% of patients with active atopic dermatitis (AD). Two out of the 5 patients with AD and concomitant celiac disease had IgA-anti-TG1 and IgA-anti-TG2 antibodies.
24828664 TGM2 may be a useful cell surface biomarker for early detection of esophageal adenocarcinomas.
24778599 that homozygous deletion of TG2 in mice does not result in an embryonic lethal phenotype, suggesting that compensation for its absence may be achieved by other family members
24732400 TGM2 was identified as a stable interaction partner of collagen VII and is reduced in recessive dystrophic epidermolysis bullosa.
24725450 Taken together, we conclude that resveratrol induces conformational changes in TG2, and that Ca(2+)-mediated TG2 association with the plasma membrane is responsible for the inhibitory effects of resveratrol on cell migration.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of transglutaminase 2 (TGM2) in primary human brain microvascular endothelial cells
24610445 TGase 2 inhibitor GK921 abrogates RCC growth in xenograft tumor models, suggesting the possibility of a new therapeutic approach to RCC.
24603819 perturbed transglutaminase 2 activity has a role in the arrested alveolarisation associated with BPD
24583754 As severity of villous abnormality increases, titer of anti-tTG also rises. Presence of villous atrophy can be predicted at very high anti-tTG ab titer.
24569994 tTG has an intrinsic capability to stimulate cell survival through a novel mechanism that activates PI3-kinase signaling events
24494193 Data show that GlxI is a novel substrate of TG2 and TG2 catalyzes either polyamine conjugation or deamidation depending the presence of polyamines.
24481335 These results demonstrate that the accumulation of misfolded proteins activates TGase2, which further accelerates the formation of protein aggregates.
24477458 A TG2-induced shift in glucose metabolism helps breast cancer cells to survive under stressful conditions and promotes their metastatic competence.
24464646 The increased frequency of apoptosis correlated with the increase in transglutaminase expression and the highest rates of apoptosis were found in cells transfected with the potent TG isoform as compared to the full length TGC.
24375797 Pulmonary arterial hypertension is associated with a heightened state of activation of TG2. [Review]
24375405 TG2-dependent GAPDH deamidation was suggested to participate in actin cytoskeletal remodeling.
24352382 Majority of untreated dermatitis herpetiformis patients have similar gluten-dependent TG2-specific IgA deposits the small bowel mucosa as coeliac disease patients.
24349085 TG2 contributes to apoptosis induction in Jurkat T cells by modulating Ca2+ homeostasis via cross-linking RAP1GDS1.
24325651 Results suggest that high-titre tissue transglutaminase-2 (TTG2) antibodies predict small bowel villous atrophy, but decision cut-off limits must be locally validated.
24291354 TG2 may be involved not only in insulin secretion, as suggested by our previous studies in cytoplasmic INS-1E fraction, but also in the regulation of glucose-induced gene transcription.
24193434 Future studies investigating these hypotheses on TG-2-paxillin relationships are necessary in order to address this fundamental process in cell matrix adhesion signaling.
24191290 We identify a novel pathogenic involvement of TG2 in preeclampsia but also suggest a previously unrecognized role of TG2 in the regulation of G protein-coupled receptor stabilization by inhibiting ubiquitination-dependent degradation.
24175906 Report inhibition of transglutaminase 2 by two small electrophilic molecules in the treatment of pulmonary fibrosis.
24130874 In endothelial cells CD IgA mediate the constitutive activation of extracellular TG2 by a mechanism involving the redox sensor protein TRX.
24085483 The expression of tTG increased in human colorectal cancer and cantharidinate inhibited the expression of tTG.
24058567 Accumulation of TG2 in tumor stroma is an independent risk factor for identifying breast cancer patients at high risk of recurrence.
24052076 TG2 inhibition results in inhibition of fibronectin deposition in human umbilical vein endothelial cell monocultures with a parallel reduction in matrix-bound VEGFA.
23993960 TGM2 binds directly to the extracellular domain of LRP6, which is also able to act as a substrate for TGM2-mediated protein cross-linking.
23966323 Data suggest binding of autoantibodies to TGM2 in vascular endothelium of endometrium and consequent functional inhibition represent key mechanism by which anti-TGM2 antibodies alters embryo implantation and placentation in women with celiac disease.
23941696 Val224 increases TG2 activity by modulating its calcium-binding affinity enabling transamidation reactions inside cells.
23877317 High TGM2 expression is associated with glioma.
23853482 TG2 expression levels can predict progression free survival in patients with non-small cell lung cancer treated with epidermal growth factor receptor tyrosine kinase inhibitor.
23817628 Two isoforms of human TG2 were cloned from human erythroleukemia (HEL) cells induced with retinoic acid. RA treatment induced a sevenfold increase in the level of TGC in HEL cells and was accompanied by its translocation to cell membranes.
23804301 TG2 transamidation reactions using intact cells, cell lysates, and recombinant YB-1 revealed covalent crosslinking of the 50 kDa YB-1 polypeptide into protein oligomers
23765377 We conclude that an OSMR/TGM2/integrin-alpha5beta1/fibronectin pathway is of biological significance in cervical squamous cell carcinoma
23730209 Extracellular TG2 activates noncanonical NF-kappaB signaling and promotes peritoneal dissemination of ovarian cancer metastasis.
23673317 In this review, we discuss recent evidence that TG2-regulated pathways contribute to the aggressive phenotype in breast cancer.
23640056 Data indicate that tissue transglutaminase (TG2) regulates beta-catenin expression and function in ovarian cancer (OC) cells and define the c-Src-dependent mechanism through which this occurs.
23576428 Studied expression of transglutaminase 2 (TG2) in 511 acute myeloid leukemia (AML) samples using reverse phase proteomic arrays. It was demonstrated that TG2 expression was higher at relapse than diagnosis in many cases.
23538006 TG2 expression in the maximally dilated portion of abdominal aortic aneurysms was enhanced and may stabilize extracellular matrix.
23499501 TGM2 up-regulation along with ITGB1 and SDC4 plays an important role in the development of RCC tumors and advanced RCC with metastasis
23454274 Data suggest that a subset of patients with coeliac disease produce autoantibodies against PKCdelta and that this response may stem from a tTG-PKCdelta substrate interaction.
23290789 Results suggest that Tgase-2/PP2A/JNK might be a novel axis that affects N-cadherin switching in the epithelial-mesenchymal-transition (EMT) of A549 lung cancer cells.
23276939 TGM2 mRNA is regulated by alternative splicing, producing C-terminal truncated forms of TGM2 that are predicted to have distinct biochemical properties and biological functions in cancer, neurodegeneration, inflammation and wound healing[review]
23224146 NF-kappaB induces TG2 expression, TG2 activates NF-kappaB activity.
23200849 Transglutaminase-2 interacted with adenylylcyclase 8 and promoted cAMP production and the responsiveness of down-stream effectors of cAMP via the transglutaminase activity of transglutaminase-2.
23185316 these findings show for the first time a direct link between TG2, NF-kappaB, and HIF-1alpha, demonstrating TG2's important role in cancer progression.
23122413 Together, our data suggest that tTG and its activity might play a differential role in the development and progression of CAA.
23085087 Kinetic characterization of recombinant human TG2 using a wide variety of substrates and inhibitor.
23085038 Nuclear TG2 in the closed conformation and non-nuclear TG2 in the open conformation have opposing effects on hypoxic/hypoglycemic cell death, which could explain previous controversial results.
23076164 In patients with ST-elevation myocardial infarction undergoing percutaneous coronary intervention, high GGT levels are associated with increased long-term mortality.
22923476 C-peptide prevents hyperglycemia-induced endothelial apoptosis through inhibition of reactive oxygen species-mediated transglutaminase 2 activation.
22921425 Oscillatory shear stress increases endothelial transglutaminase activity.
22782215 A protective role of TG-2 enzymatic activity in melanoma progression in vivo.
22750506 On binding to apical CD71, SIgA (with or without gliadin peptides) enters a recycling pathway and avoids lysosomal degradation, allowing transcytosis of bound peptides. This process may be facilitated by Tgase2 in celiac disease.
22698685 An increase in TG2 does not significantly modify the onset nor the progression of the behavioral phenotype and neuropathological features of R6/2 transgenic mice.
22652528 treating the amniotic membrane with the cross-linking enzyme, TG2, results in a novel biomaterial with enhanced mechanical and biological characteristics
22493284 work establishes a novel ATM-dependent signaling loop where TG2 and NFkappaB activate each other resulting in sustained activation of NFkappaB and acquisition of a drug-resistant phenotype
22460364 Slow progression into S-phase in gamma-tocopherol treated prostate cancer cells is marked by increased TG2 expression and decreased CyclinsE and D1.
22458929 BNIP3 expression and TGM2 expression are independent prognostic factors in laryngeal SCC patients receiving postoperative radiotherapy.
22451718 demonstrate that TGase2 is responsible for a pathogenic amplification loop facilitating IgA1-sCD89 deposition and mesangial cell activation, thus identifying TGase2 as a target for therapeutic intervention in this disease
22442151 TG2-heparin binding mutants supported only weak RGD-independent cell adhesion compared with wild type TG2 or mutants with retained heparin binding, and both heparin binding clusters were critical for TG2-mediated cell adhesion
22418443 PDT-activated calpain was responsible for the sequential events of Bax translocation, the collapse of DeltaPsi(m), caspase-3 activation, and AIF translocation, all of which were provoked by TG2 activation.
22385244 IFN-gamma, a dominant cytokine in intestinal mucosa in active celiac disease, is the most potent inducer of Transglutaminase 2, and synergism with TNF-alpha may contribute to exacerbate the pathogenic mechanism of celiac disease.
22382775 TG2 is localized close to insulin and glucagon granules in human pancreatic islet.
22366952 this study reveals several previously unrecognized aspects of the TG2-specific autoantibody response in celiac disease, primarily the abundance and mutation profile of TG2-specific plasma cells, and the limited inhibitory activity of the antibodies
22364871 [review] A vast array of biochemical activities of TG2 accounts for its involvement in a variety of cellular processes, including adhesion, migration, growth, survival, apoptosis, differentiation, and extracellular matrix organization.
22326684 [review] TGM2 exerts at least two crucial roles in celiac disease: as a deamidating enzyme, that can enhance the immunostimulatory effect of gluten, and as a target autoantigen in the immune response.
22320917 Report ethanol/free fatty acids provoke generation of truncated short form of TG2, inducing its nuclear localization.
22298777 Here, through molecular modeling and mutagenesis, we have identified the heparan sulfate-binding site of TG2 (202)KFLKNAGRDCSRRSSPVYVGR(222).
22231926 TG2 appears essential for ECV304 cell vasculogenic tube formation in a coculture model.
22228808 IFN-gamma mediated activation of TG2 requires phosphatidylinositol-3-kinase (PI3K) activity but is uninfluenced by a number of other kinases reported to be active in T84 human enterocytic cells.
22225906 Aberrant expression of transglutaminase 2 in drug-resistant and metastatic cancer cells facilitates cell survival and invasive functions independently of its transamidation activity.
22220479 Transglutaminase-mediated remodeling of the human erythrocyte membrane skeleton.
22220477 Transglutaminase 2 dysfunctions in the development of autoimmune disorders.
22220476 Tissue TGM2 role in cancer progression.
22220475 Transglutaminase 2 at the crossroads between cell death and survival.
22220474 Transglutaminase 2: a new paradigm for NF-kappaB involvement in disease.
22220472 Physiopathological roles of human transglutaminase 2.
22220471 Structure and regulation of type 2 transglutaminase in relation to its physiological functions and pathological roles.
22198767 A single conformational transglutaminase 2 epitope contributed by three domains is critical for antibody binding in celiac disease.
22160262 Frequencey and impact of genetic variations in the human TG2 gene.
22139411 The capacity of transamidation by TG2 to regulate activation of latent TGF-beta seems to have a potential impact on the regulation of inflammatory response in osteoarthritic tissues. [Review]
22130737 The role of TG2 in human cancer and drug resistance. [Review]
22089883 A significant correlation in the expression of canonical and alternative TG2 isoforms in normal human tissue, but differences in alternative splicing of TG2 in cancer cells
22086212 Human type 2 transglutaminase specifically modified glutamine 13 in the N-terminal region of troponin T.
22083892 Inflammatory signals, which induce epithelial to mesenchymal transition, also induce TG2 expression, suggesting a link between TG2, inflammation and cancer progression.
22080209 TG1 and TG2 isoenzymes are highly active with the major activity attributed to TG1 in human saliva.
22038180 Anti-tissue transglutaminase antibodies, both commercial and from a celiac disease patient, induce a rapid Ca(2+) mobilization from intracellular stores.
21984378 Nitric oxide regulates intracellular versus extracellular TG2 localization in vascular cells and tissue, likely via S-nitrosation.
21971542 Review: report accuracy of tissue transglutaminase antibodies in diagnosing celiac disease in pediatric population.
21967801 TG2 is an important link in IL-6-mediated tumor aggressiveness, and that TG2 could be an important mediator of distant metastasis in patients with advanced breast
21963846 TGF-beta-induced TG2 enhances ovarian tumor metastasis by inducing epithelial-to-mesenchymal transition and a cancer stem cell phenotype
21943122 Transglutaminase 2 as an independent prognostic marker for survival of patients with non-adenocarcinoma subtype of non-small cell lung cancer
21935707 Transglutaminase 2 might be protective against NMDA-evoked excitotoxic insult in neuronal-like SH-SY5Y cells.
21908620 Activation of extracellular transglutaminase 2 by thioredoxin.
21840417 Transglutaminase-2 is involved in sphingosylphosphorylcholine-induced phosphorylation and perinuclear reorganization of Keratin 8 (K-8) by activating c-Jun N-terminal kinase (JNK) and forming a triple complex with K8 and JNK.
21830119 current data suggest that TG2 is secreted from the cell via microparticles through a process regulated by TG2 cross-linking
21818567 different properties of TG2 involve this protein in various physiological processes, which if not regulated appropriately can also lead to its involvement in a number of diseases
21777419 TG2 acts, at least in part, through activation of the PI3K/Akt and NF-kappaB signaling systems, which then induce the key mediators Snail and MMP-9 that facilitate the attainment of a mesenchymal phenotype.
21757696 FXIIIa and TG2 act similarly on glutamines at either end of (1-5)F1 and transamidation specificity of both enzymes is achieved through interactions with the intact 29K fragment.
21678409 interplay between membrane lipid peroxidation, t-TGase activity, and COX-2 expression levels in the tissue adjoining to neoplastic lesion during breast cancer progression
21525012 Epidermal growth factor receptor-mediated tissue transglutaminase overexpression couples acquired tumor necrosis factor-related apoptosis-inducing ligand resistance and migration through c-FLIP and MMP-9 proteins in lung cancer cells
21441900 TG2 is expressed in HPV infection as an early phenomenon, not restricted to high-risk genotypes.
21359202 Regions of aberrant DNA methylation which were consistent with alteration of TGM-2, MMP-2, and CD24 transcript and protein expression.
21304968 the conformational state of TG2 is likely an important determinant in cell survival and the prominent function of TG2 in ischemic cell death is as a scaffold to modulate cellular processes
21226238 TG2 expression is higher in human chondrocytes undergoing apoptosis, and inhibition of TG2 leads to increased apoptosis.
21129482 matrix synthesis and early stages of chondrogenic differentiation are regulated through a novel mechanism involving transglutaminase 2 dependent inhibition of protein kinase A
21124911 Data show that TG2 as well as gastrointestinal proteolysis play important roles in the selection of gluten T-cell epitopes in celiac disease.
21036738 study suggests that fibronectin (FN) and tissue transglutaminase (TG2) facilitate the metastatic activity of A431 tumor cells, and this may be partly attributed to TG2 enhancement of the association of FN and beta integrin
21036168 syndecan-2 and syndecan-4 regulate the compensatory effect of TG-FN on osteoblast cell adhesion and actin cytoskeletal formation in the presence of RGD peptides
20967228 This study suggest that TGM2 expression in untransformed mammary epithelial cells induce EMT and stem cell phenotype which increase the invasive and survival potential of mammary epithelial cells
20929862 RGD-independent cell adhesion via a tissue transglutaminase 2-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 and {alpha}5{beta}1 integrin co-signaling.
20926141 TGM2 may be involved in dysfunction of the immune system in schizophrenia
20926141 Observational study of gene-disease association. (HuGE Navigator)
20874003 A significant correlation between GPR56, TG2, and NF-kappaB was observed that correlated with nodal metastasis and tumor invasion in esophageal squamous cell carcinoma.
20739659 TG2 is involved in the expression of a large number of all-trans-retinoic acid-regulated genes in NB4 acute promyelocytic leukemia
20731658 We speculate that TG2 mediates the enhanced interaction of astrocytes with fibronectin in the extracellular matrix of MS lesions, thereby contributing to astrocyte adhesion and migration, and thus in tissue remodeling and possibly glial scarring.
20731657 tissue transglutaminase localization to granular endoplasmic reticulum compartments is specific for stressed melanized neurons in Parkinson's disease brain
20717931 Protection against mitochondrial stress in the ocular surface targeting TGM-2 may have important implications in the survival of cells in hyperosmolar stress.
20676023 TG2 protects cells from Ca2+ ionophore-induced cell death by inhibiting mitochondria-mediated apoptotic pathway through regulation of Bax.
20659425 TGase 2-mu-calpain system is significant in the NF-kappaB pathway via I-kappaBalpha polymerization and subsequent degradation.
20615646 TG2 has a potential role of extracellular matrix protector in aortic walls during remodeling of the abdominal aortic aneurysms.
20596752 Transglutaminase 2 gene is aberrantly hypermethylated in glioma.
20547769 Findings suggest that oxidation is likely to influence the amount of active TG2 present in the extracellular environment.
20489165 Decreased S-nitrosylation of transglutaminase 2 leads to enhanced matrix crosslinking and contributes to age-related vascular stiffness.
20488756 coeliac disease patient IgA autoantibodies directed against tTG interfere with the crosslinking activity of the enzyme
20450932 the crystal structure of human TG2 in complex with adenosine triphosphate (ATP)
20450916 Inhibition of tissue transglutaminase 2 sensitizes TRAIL-resistant lung cancer cells through upregulation of death receptor 5.
20437185 The TG2 up-regulation is required for the functional THP-1 monocyte activation induced by Abeta1-42.
20371597 TG2 plays an important role in regulating the response of DCs to LPS and could be a candidate target for treating endotoxin-induced sepsis.
20156196 Endostatin and TG-2 are co-localized in the extracellular matrix secreted by endothelial cells under hypoxia, which stimulates angiogenesis.
20080707 findings identify tissue transglutaminase as a key participant in an EGFR/Src-signaling pathway in breast-cancer cells and a potential target for inhibiting EGFR-promoted tumor progression.
20052409 study found that TGM2, a mediator that is novel to asthma pathogenesis, is overexpressed in asthmatic airways and functions to increase sPLA(2)-X enzymatic activity
20033322 High TGM2 expression is associated with colorectal cancer.
20007697 Data show that TG2-L and TG2-S enhanced neuroblastoma cell differentiation due to N-Myc small interfering RNA, and suppression of vasoactive intestinal peptide (VIP) expression alone induced neuroblastoma cell differentiation.
19937343 TG2 serves as an additional biomarker for all grades of cervical dysplasia, especially for low-grade dysplasia.
19931242 Angiocidin was a preferred substrate for tTgase forming high molecular weight cross-linked multimers when treated with tTgase.
19912255 Data show that the infection-triggered anti-transglutaminase antibodies have the same biological properties as that of the coeliacs, with the same in-vivo potential for damage.
19878304 Functional significance of five noncanonical Ca2+-binding sites of human transglutaminase 2 characterized by site-directed mutagenesis
19840940 TG2 regulates levels of cellular GTP-bound Rac and actin cytoskeletal reorganization through a new mechanism involving direct inhibition of Bcr GTPase-activating activity.
19838207 Data show that hypoxia induces TG2 expression through HIF-1 dependent pathway, and activation of TG2 inhibites caspase-3 activity by forming crosslinked multimer, and activates nuclear factor (NF)-kappaB pathway.
19756726 Tissue transglutaminase up-regulation does not seem to be specific for celiac disease and can appear in other pathological conditions.
19680746 The activity of TG2 and RhoA is altered in Celiac disease causing increased blood vessel permeability.
19657147 Increased TG2 expression can result in induction of transforming growth factor beta1, causing increased synthesis and deposition of matrix proteins, which can be regulated by nitric oxide.
19655169 Data indicate that GlcN and its metabolite GlcN6P can down-regulate constitutive activation of NF-kappaB in vivo via inhibition of TGase 2.
19632032 Cystamine may be an effective sensitizer of TRAIL-induced apoptosis in cancer cells expressing high levels of TG2.
19628791 Induction of transglutaminase 2 by a liver X receptor/retinoic acid receptor alpha pathway increases the clearance of apoptotic cells by human macrophages.
19625650 In cystic fibrosis airway epithelia, TG2 may function as a link between oxidative stress and inflammation by driving the decision as to whether a protein should undergo SUMO-mediated regulation or degradation.
19619546 Data suggest that transglutaminase 2 is overexpressed in cystic fibrosis and affects nucleoside diphosphate kinase function.
19562471 TDI exposure may activate tTG via ROS-mediated mechanism in the airway epithelium leading to persistent airway inflammation in toluene diisocyanate-induced occupational asthma patients.
19403524 TGase plays a key role in cancer cell motility and invasiveness and represents a previously unappreciated participant in the EGF pathway that stimulates these processes in cancer cells
19342211 mediates deamidation of gluten antigen fragments involved in initiation of celiac disease
19324884 Tissue transglutaminase-2 and matrix metalloproteinase-2 expression are significantly correlated in vivo, in peritoneal xenografts and in human ovarian tumors.
19278990 evidence for overexpression in oral submucous fibrosis and its regulation by arecoline in oral fibroblasts
19183553 Degradation of TG2 by calcium-mediated ubiquitination responding to high oxidative stress is reported.
19182256 Observational study of gene-disease association. (HuGE Navigator)
19013523 TG2 contributes to extracellular matrix (ECM) accumulation primarily by accelerating collagen deposition, but also by altering the susceptibility of the tubular ECM to decay
18923241 Report increased tissue transglutaminase expression in human atherosclerotic coronary arteries.
18849643 A proteomic analysis of proteins expressed in intraductal papillary mucinous neoplasms showed that DMBT1 and TGM2 were both upregulated in these lesions.
18809380 These results suggest that TGase 2 inhibits MMP-9 via downregulation of MMP-9 transcription activity by blocking the binding of the Jun-fos complex to an AP-1 site.
18804908 glucosamine efficiently promotes cell death via inhibiting TGase 2-mediated NF-kappaB activation in drug-resistant breast cancer cells
18793760 TG2 can hydrolyze iso-peptide bonds between two peptide substrates.
18673368 Transglutaminases demonstrate cross-linking activity in Alzheimer lesions, suggesting TG1 and TG2 are involved in protein aggregation processes underlying formation of senile plaques, amyloid angiopathy and/or neurofibrillary tangles in Alzhemier disease.
18667446 TG2 prevents apoptosis induced by cisplatin by activating the NF-kappaB survival pathway in ovarian cancer cells.
18632639 TG2 may have a role in progression of ovarian carcinoma
18587533 TG2 activity was markedly elevated in meningiomas and TG2 was found to co-localize with fibronectin. These findings support a potential protective role for TG2 in meningiomas.
18584285 results demonstrated that TG2 expression differently influences cartilage destruction and bone remodeling
18561261 The TGM2 gene is associated with schizophrenia in a British population.
18561261 Observational study of gene-disease association. (HuGE Navigator)
18544639 results identify a unique functional network between two cartilage TGC isoenzymes that accelerates chondrocyte maturation without requirement for TGC-catalyzed transamidation by either TGC
18505736 Data suggest that tTG binds equally effective to wild-type and disease mutant alpha-synuclein variants.
18499669 TG-FN binding to syndecan-4 activates PKCalpha leading to its association with beta(1) integrin, reinforcement of actin-stress fiber organization, and MAPK pathway activation
18490773 findings show that a defective CFTR induces up-regulation of TG2 in tissues & cell lines; increased TG2 activity leads to functional sequestration of peroxisome proliferator-activated receptor gamma & increase of the classic parameters of inflammation
18474442 results show that,after mechanical damage, transglutaminase 2 appeared to contribute to membrane resealing
18381937 TG2 expression in Pancreatic ductal adenocarcinoma promotes degradation of PTEN and results in constitutive activation of focal adhesion kinase/AKT cell survival signaling.
18375543 TG2 is up-regulated in neurons exposed to oxygen and glucose deprivation (OGD), and increased TG2 expression protects neurons against OGD-induced cell death independent of its transamidating activity.
18353867 To elucidate the functional role of TGase2 activation in cells under the oxidatively stressed condition, we identified the mediator that activates TGase2.
18312620 The aim was to establish whether autoantibody secretion to organ culture supernatants in treated celiac disease patient biopsies is related to the duration of the diet and further to the pre-existence of mucosal TG2-specific IgA deposits.
18235007 This study demonstrated that both normal and glaucomatous trabecular meshwork cells express TGM2. In addition, TGM2 protein levels and enzyme activities were elevated in GTM cells.
18174247 TGM2 gene is a target for epigenetic silencing in breast cancer and suggests that this aberrant molecular event is a potential marker for chemotherapeutic drug sensitivity
18092889 create a foundation for understanding the catalytic as well as the non-catalytic roles of TG2 in biology
18052077 GTP-binding-defective TGase-2 mutants induced cell death
17939176 Observational study of gene-disease association. (HuGE Navigator)
17939176 reduced TG2 activity can contribute to disorders of glucose metabolism possibly via an impairment of insulin secretion
17924658 mass spectrometric analysis provided the first unambiguous identification of Thr381 as the active site nucleophile of human gamma-glutamyltranspeptidase, and confirmed four of the seven N-linked glycosylation sites
17890909 Dermal fibroblasts and histiocytes of NSF express transglutaminase-2 (TG2), CD68, factor XIIIa, and transglutaminase isopeptide, indicating increased expression and/or activation of transglutaminases in nephrogenic systemic fibrosis.
17762854 intestinal damage is associated with the production of anti-tTG IgA and anti-TGe IgA in dermatitis herpetiformis patients
17711877 transglutaminase interacts in vitro and on the cell surface with the major endocytic receptor, low-density lipoprotein receptor-related protein 1, and demonstrate the requirement for this receptor in the endocytosis of transglutaminase.
17671187 Up-regulated TG2 is associated with enhanced peritoneal ovarian tumor dissemination
17625111 These findings suggest that transglutaminase-mediated cross-linking stabilizes the particulate material shed from the placenta.
17609251 The abundance of alternatively spliced C-terminal truncated tissue transglutaminase forms and their distinct intracellular expression patterns in human vascular cells and leukocytes indicate these isoforms likely have unique physiological functions.
17476115 Transglutaminase-2-mediated vimentin dimerization produces a novel unifying pathway by which vasodilatory and remodeling responses may be regulated.
17442486 aggregates of mutant ataxin-l may recruit calbindin-D28k via tissue transglutaminase 2 mediated covalent crosslinking
17440814 TG2 can induce apoptosis in pancreatic ductal adenocarcinoma cells in an AIF-dependent and caspase-independent manner.
17403029 mutant htt alters the activation of type 2 transglutaminase in response to certain stimuli
17374730 These results suggest a novel mechanism of regulation of TG2 and TG2-mediated autophagy in pancreatic cancer cells.
17314516 Review identifies an expressed ligand that interacts with GPR56 in metastatic melanoma cells as TG2, a major crosslinking enzyme in the tumor extracellular matrix.
17228174 present study showed a correlation between Tg-2 expression and renal function and pathological changes.
17189522 Data suggest that transglutaminase 2 interactions with osteopontin lead to protein polymerization that facilitates macrophage adhesion to the calcified elastic lamellae to promote clearance of the ectopic mineral deposits.
17171363 Children who were classified as transglutaminase antibody-positive if antibodies were detected developed autoantibodies.
17043648 TG2 expression in breast cancer cells plays an important role in the development of the metastatic phenotype.
16951195 TG2 induces constitutive activation of NF-kappaB in tumor cells via a novel pathway that is most likely independent of I kappaB alpha kinase.
16914140 Endothelial cell tissue transglutaminase (tTG) might be involved in modulation of the cellular response to VEGF by forming an intracellular complex with VEGFR-2, and mediating its translocation into the nucleus upon VEGF stimulation.
16826431 Increased transglutaminase-2 protein expression in both malignant breast epithelium and surrounding stroma, although its selective spatial expression pattern in normal tissues also indicates a physiological role in stromal-epithelial interactions.
16757564 Results show that GPR56 binds specifically to tissue transglutaminase, TG2, a widespread component of tissue and tumor stroma previously implicated as an inhibitor of tumor progression.
16720350 increase in TGase 2 in the neuroblastoma causes functional changes in transcriptional regulation, especially in genes associated with inflammation
16522628 intracellularly, under physiological conditions, TG2 is maintained largely as a latent enzyme, its calcium-activated cross-linking activity being suppressed allosterically by guanine nucleotide binding
16449978 Expression of TG2 in breast cancer cells contributes to the development of the drug-resistance phenotype by promoting interaction between integrins and fibronectin.
16439457 progesterone receptor, calcitonin, and tissue tranglutaminase are involved in a signaling pathway in Ishikawa endometrial cells
16407273 These studies suggest a novel role for tissue transglutaminase 2 in the regulation of chromatin structure and function.
16382148 tTGase is a new type of caspase 3 inhibitor in THG-mediated apoptosis.
16368554 analysis of transglutaminase-2 and its substrates in human diseases [review]
16368540 analysis of the expression, localization and activity of TG2 and FXIIIA in mineralizing tissues [review]
16338459 tTG protein and mRNA express in stromal cells and trophoblast in first trimester and at term, with higher levels later in pregnancy.
16313886 TG2 modification of tumor protein p53 could be an additional mechanism whereby TG2 could facilitate apoptosis
16301118 Yeast 2-Hybrid experiments identified a strong and novel interaction between the transglutaminase moiety and protein kinase A anchor protein 13 (AKAP13)
16300411 transglutaminase 2-mediated cross-linking of serine protease inhibitors elafin and trappin-2 to neutrophil serine proteinases preserves their inhibitory capacities
16285941 novel and unexpected biological role for surface TG2 in the pathogenesis of celiac disease
16153302 TG2-induced alterations in the extracellular matrix could effectively inhibit the process of metastasis
16146777 Tissue transglutaminase (TG2) is a wound response enzyme [review]
16146727 review of protein modifications mediated by transglutaminase 2 in human viral diseases [review]
16146723 TG2 expression can contribute to the development of drug-resistant and metastatic cancer cell phenotypes [review]
15886239 tTG actively participates in adhesion events at the embryo-maternal interface through its interaction with FN, at least in part, by activating integrin-signaling pathways
15752564 immunostaining for TG2 revealed substantial presence of this protein in single, damaged muscle fibers and a weak reaction in regenerating fibers appearing in polymyositis/dermatomyositis patients' specimens
15746535 Autoantigen in celiac disease. Review.
15715085 In HEK 293T cell culture, transglutaminase 2 cross-links the N-terminal fragments of mutant huntingtin protein, therefore it could be involved in the cross-linking of huntingtin into intranuclear inclusions in Huntington disease.
15691824 externalized GTP-bound TG2 serves as a molecular switch for differentiation of chondrocytes to a hypertrophic, calcifying phenotype in a manner that does not require either TG2 transamidation activity or fibronectin binding
15585642 up-regulation of TG2 expression is associated with drug-resistance and metastasis of breast cancer
15556610 Overexpression of TGM2 accelerates the erythroid differentiation of chronic myeloid leukemia cell line through PI3K/akt signaling pathway.
15471861 Transglutaminase 2 induces nuclear factor-kappaB activation via a novel pathway
15460447 Tissue transglutaminase is unlikely to be a contributing factor to the formation of aggregates of alpha-synuclein in a stable cell model.
15362860 Data describe the role of the MT1-MMP/MMP-2 protease tandem in the regulation of cell receptors and explain the underlying biochemical mechanisms of tissue transglutaminase proteolysis at the normal tissue/tumor boundary.
15272014 EGF failed to block RA-induced TGase expression; EGF alone potently up-regulated TGase expression and activation in breast cancer cells; results suggest that TGase activation is necessary and sufficient for the antiapoptotic properties of EGF
15220331 GTP-bound G(h)/TG2has a role in inhibiting cell migration migration through interaction with cytoplasmic tail of integrin alpha subunits
15201665 Correlated with initiation and progression of scarring on sequential biopsies from renal-allograft recipients with chronic allograft nephropathy(CAN). Elevated tTg may predict of development of CAN. tTg may be attractive therapeutic target.
15199098 transglutaminase 2 has a role in fibroblast wound healing and extracellular matrix remodelling
15069073 Tissue transglutaminase has intrinsic kinase activity and is an insulin-like growth factor-binding protein-3 kinase
15001552 Iintramolecular crosslinking of the cytoplasmic soluble phospho-Ser alpha-synuclein monomer is initially catalyzed by tissue transglutaminase.
14985437 Inhibiting the interaction of calmodulin with transglutaminase and huntingtin protein could decrease cross-linking and diminish huntingtin aggregate formation in the HD brain
14752105 transglutaminase 2 is activated by oxidative stress or ultraviolet irradiation and has a role in transglutaminase 2 in age-related cataractogenesis
14747475 six lysine residues of TG2 were found to participate in isopeptide bond formation with gliadin
14631123 the level of TGase 2 expression was found to be specifically increased in polymyositis and dermatomyositis, but not in Duchenne muscular dystrophy and normal controls.
12960346 Tissue-type transglutaminase TGM2 plays a significant role in mediating CD8+ T cell migration across cytokine-activated endothelium and infiltration of tissues during inflammation.
12743114 Tissue transglutaminase directly regulates adenylyl cyclase resulting in enhanced cAMP-response element-binding protein (CREB) activation.
12698366 results showed that Fas and/or Fas-Ligand, Bcl-2, and tissue transglutaminase may be involved in apoptotic pathways leading to mucosal atrophy in children with coeliac disease
12528814 Transglutaminase 2 isoform colocalizes with both huntingtin protein and epsilon-(gamma-glutamyl) lysine covalent cross-links in intranuclear inclusions in Huntington disease.
12527383 These data indicate that the in situ activity of TGase 2 gives different results with different substrates, and suggest the possibility of overrepresentation of in situ TGase 2 activity when assayed with BP
12438565 TGM2 was identified using a trifunctional phenyl sulfonate probe.
12410804 tissue transglutaminase expression in the small intestine in children with coeliac disease
12387450 products accumulate abnormaly in skeletal muscle and erythrocytes of chorea-acanthocytosis patients
12205028 Detection of a putative mutation in a MODY patient identifies transglutaminase 2 as a potential candidate gene in type 2 diabetes
12093810 specificity is involved in selection of gluten T cell epitopes and the deamidation reaction of gluten peptides in celiac disease is taking place in slightly acidic environments
12061780 GTP is required to stabilize and display transamidation activity of transglutaminase 2.
11762979 Microarray analysis indicates HIV-1 Tat-induced upregulation of transglutaminase 2 (TGM2) in primary human brain microvascular endothelial cells
11742196 Observational study of gene-disease association. (HuGE Navigator)
10561600 N-terminal and C-terminal regions of TGM2 interact with each other in determining the structure of the native protein
7906657 Microarray analysis indicates HIV-1 Tat-induced upregulation of transglutaminase 2 (TGM2) in primary human brain microvascular endothelial cells
7688299 Microarray analysis indicates HIV-1 Tat-induced upregulation of transglutaminase 2 (TGM2) in primary human brain microvascular endothelial cells

AA Sequence

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQE      1 - 70
AGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFN     71 - 140
AWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRD    141 - 210
CSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVF    211 - 280
AAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPG    281 - 350
YEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL    351 - 420
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFD    421 - 490
VFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEKYRDCLTESNL    491 - 560
IKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLT    561 - 630
EEQKTVEIPDPVEAGEEVKVRMDLLPLHMGLHKLVVNFESDKLKAVKGFRNVIIGPA                 631 - 687
//

Text Mined References (335)

PMID Year Title
26702927 2015 The transglutaminase type 2 and pyruvate kinase isoenzyme M2 interplay in autophagy regulation.
26542019 2015 P2X7 receptor activation regulates rapid unconventional export of transglutaminase-2.
26307914 2015 Lack of genetic association of the TGM2 gene with schizophrenia in a Chinese population.
26250429 2016 Isopeptidase activity of human transglutaminase 2: disconnection from transamidation and characterization by kinetic parameters.
26244572 2015 Enhanced B-Cell Receptor Recognition of the Autoantigen Transglutaminase 2 by Efficient Catalytic Self-Multimerization.
26184652 2015 IgG anti-tTG responses in different autoimmune conditions differ in their epitope targets and subclass usage.
26160175 2015 Structural Basis for Antigen Recognition by Transglutaminase 2-specific Autoantibodies in Celiac Disease.
26153762 2016 Responsive population dynamics and wide seeding into the duodenal lamina propria of transglutaminase-2-specific plasma cells in celiac disease.
26133787 2015 Tissue Transglutaminase contributes to experimental multiple sclerosis pathogenesis and clinical outcome by promoting macrophage migration.
26133738 2015 Transglutaminase 2 up-regulation is associated with RANKL/OPG pathway in cultured HPDL cells and THP-1-differentiated macrophages.
26041746 2015 Tissue Transglutaminase Mediated Tumor-Stroma Interaction Promotes Pancreatic Cancer Progression.
25934693 2015 miR-19-Mediated Inhibition of Transglutaminase-2 Leads to Enhanced Invasion and Metastasis in Colorectal Cancer.
25934691 2015 Transglutaminase Is Required for Epidermal Squamous Cell Carcinoma Stem Cell Survival.
25808416 2015 Transglutaminase 2 interactions with extracellular matrix proteins as probed with celiac disease autoantibodies.
25547897 2015 Transglutaminase 2 is involved in homocysteine-induced activation of human THP-1 monocytes.
25449226 2015 Transglutaminase 2 interacts with syndecan-4 and CD44 at the surface of human macrophages to promote removal of apoptotic cells.
25419572 2014 Identification of transglutaminase reactive residues in human osteopontin and their role in polymerization.
25404341 2014 Activity-regulating structural changes and autoantibody epitopes in transglutaminase 2 assessed by hydrogen/deuterium exchange.
25398223 2015 Transglutaminase 2 and neuroinflammation.
25247996 2014 Transglutaminase 2 expression is increased as a function of malignancy grade and negatively regulates cell growth in meningioma.
25243117 2014 New biomarkers to predict the evolution of in situ breast cancers.
25215932 2014 Elongation factor-2 kinase regulates TG2/?1 integrin/Src/uPAR pathway and epithelial-mesenchymal transition mediating pancreatic cancer cells invasion.
25209703 2014 Characterization of distinct sub-cellular location of transglutaminase type II: changes in intracellular distribution in physiological and pathological states.
25201980 2014 Aberrant calcium signaling by transglutaminase-mediated posttranslational modification of inositol 1,4,5-trisphosphate receptors.
25192068 2014 Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
25131137 2014 Characterisation of tissue transglutaminase-reactive T cells from patients with coeliac disease and healthy controls.
25060553 2015 Transglutaminase 2 ablation leads to mitophagy impairment associated with a metabolic shift towards aerobic glycolysis.
25015117 2014 Different associations between obesity and impaired fasting glucose depending on serum gamma-glutamyltransferase levels within normal range: a cross-sectional study.
24885370 2014 Low prevalence of IgA anti-transglutaminase 1, 2, and 3 autoantibodies in children with atopic dermatitis.
24828664 2014 TGM2: a cell surface marker in esophageal adenocarcinomas.
24778599 2014 Biological functionalities of transglutaminase 2 and the possibility of its compensation by other members of the transglutaminase family.
24732400 2014 Loss of collagen VII is associated with reduced transglutaminase 2 abundance and activity.
24725450 2014 Conformational changes and translocation of tissue-transglutaminase to the plasma membranes: role in cancer cell migration.
24610445 2014 Transglutaminase 2 inhibitor abrogates renal cell carcinoma in xenograft models.
24603819 2014 Transglutaminase 2: a new player in bronchopulmonary dysplasia?
24583754 2015 Titers of anti-tissue transglutaminase antibody correlate well with severity of villous abnormalities in celiac disease.
24569994 2014 A novel mechanism by which tissue transglutaminase activates signaling events that promote cell survival.
24494193 2014 Methylglyoxal in cells elicits a negative feedback loop entailing transglutaminase 2 and glyoxalase 1.
24481335 2014 Endoplasmic reticulum stress activates transglutaminase 2 leading to protein aggregation.
24477458 2014 Transglutaminase 2 reprogramming of glucose metabolism in mammary epithelial cells via activation of inflammatory signaling pathways.
24464646 2015 The 55?kDa tissue transglutaminase cross-linking active isoform TG induces cell death.
24375797 2014 Transglutaminase 2-mediated serotonylation in pulmonary hypertension.
24375405 2014 Transglutaminase 2-dependent deamidation of glyceraldehyde-3-phosphate dehydrogenase promotes trophoblastic cell fusion.
24352382 2014 Small bowel transglutaminase 2-specific IgA deposits in dermatitis herpetiformis.
24349085 2013 Transglutaminase 2 contributes to apoptosis induction in Jurkat T cells by modulating Ca2+ homeostasis via cross-linking RAP1GDS1.
24325651 2014 High-titre circulating tissue transglutaminase-2 antibodies predict small bowel villous atrophy, but decision cut-off limits must be locally validated.
24291354 2014 A possible role of transglutaminase 2 in the nucleus of INS-1E and of cells of human pancreatic islets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24193434 Transglutaminase-2 in cell adhesion: all roads lead to paxillin?
24191290 2014 Tissue transglutaminase contributes to the pathogenesis of preeclampsia and stabilizes placental angiotensin receptor type 1 by ubiquitination-preventing isopeptide modification.
24175906 2014 Inhibition of transglutaminase 2, a novel target for pulmonary fibrosis, by two small electrophilic molecules.
24130874 2013 Thioredoxin is involved in endothelial cell extracellular transglutaminase 2 activation mediated by celiac disease patient IgA.
24085483 2013 Role of tissue transglutaminase and effect of cantharidinate in human colorectal cancer.
24058567 2013 Transglutaminase 2 overexpression in tumor stroma identifies invasive ductal carcinomas of breast at high risk of recurrence.
24052076 2013 A novel extracellular role for tissue transglutaminase in matrix-bound VEGF-mediated angiogenesis.
23993960 2013 Transglutaminase 2 as a novel activator of LRP6/?-catenin signaling.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23966323 2013 Potential new mechanisms of placental damage in celiac disease: anti-transglutaminase antibodies impair human endometrial angiogenesis.
23941696 2013 Identification of a specific one amino acid change in recombinant human transglutaminase 2 that regulates its activity and calcium sensitivity.
23877317 2013 TGM2 inhibition attenuates ID1 expression in CD44-high glioma-initiating cells.
23853482 2013 Transglutaminase 2 expression predicts progression free survival in non-small cell lung cancer patients treated with epidermal growth factor receptor tyrosine kinase inhibitor.
23817628 2013 Induction and translocation of tissue transglutaminase isoforms increased phosphorylation in retinoic acid treated erythroleukemia cells.
23804301 2013 Transglutaminase-2 mediates calcium-regulated crosslinking of the Y-box 1 (YB-1) translation-regulatory protein in TGF?1-activated myofibroblasts.
23765377 2013 Tissue transglutaminase mediates the pro-malignant effects of oncostatin M receptor over-expression in cervical squamous cell carcinoma.
23730209 2013 Extracellular tissue transglutaminase activates noncanonical NF-?B signaling and promotes metastasis in ovarian cancer.
23673317 2013 Tissue transglutaminase as a central mediator in inflammation-induced progression of breast cancer.
23640056 2013 Tissue transglutaminase regulates ?-catenin signaling through a c-Src-dependent mechanism.
23576428 2013 Transglutaminase 2 expression in acute myeloid leukemia: association with adhesion molecule expression and leukemic blast motility.
23538006 2013 Transglutaminase type 2 in human abdominal aortic aneurysm is a potential factor in the stabilization of extracellular matrix.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23499501 2014 Up-regulation of TGM2 with ITGB1 and SDC4 is important in the development and metastasis of renal cell carcinoma.
23454274 2013 Protein kinase C delta is a substrate of tissue transglutaminase and a novel autoantigen in coeliac disease.
23290789 2013 Transglutaminase-2 induces N-cadherin expression in TGF-?1-induced epithelial mesenchymal transition via c-Jun-N-terminal kinase activation by protein phosphatase 2A down-regulation.
23276939 2013 TGM2 and implications for human disease: role of alternative splicing.
23224146 2013 Transglutaminase 2 and NF-?B: an odd couple that shapes breast cancer phenotype.
23200849 2013 G?(h)/transglutaminase-2 activity is required for maximal activation of adenylylcyclase 8 in human and rat glioma cells.
23185316 2012 Tissue transglutaminase constitutively activates HIF-1? promoter and nuclear factor-?B via a non-canonical pathway.
23122413 2013 Tissue transglutaminase colocalizes with extracellular matrix proteins in cerebral amyloid angiopathy.
23085087 2013 Expression, purification and kinetic characterisation of human tissue transglutaminase.
23085038 2013 Transglutaminase 2 facilitates or ameliorates HIF signaling and ischemic cell death depending on its conformation and localization.
23076164 2012 Effect of serum gamma-glutamyl transferase levels on myocardial perfusion and long-term prognosis after primary angioplasty in patients with acute ST-elevation myocardial infarction.
22923476 2013 C-peptide prevents hyperglycemia-induced endothelial apoptosis through inhibition of reactive oxygen species-mediated transglutaminase 2 activation.
22921425 2012 Transglutaminase activity regulates atherosclerotic plaque composition at locations exposed to oscillatory shear stress.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22782215 2013 Tissue transglutaminase activity protects from cutaneous melanoma metastatic dissemination: an in vivo study.
22750506 2012 Interactions among secretory immunoglobulin A, CD71, and transglutaminase-2 affect permeability of intestinal epithelial cells to gliadin peptides.
22698685 2012 Tissue transglutaminase overexpression does not modify the disease phenotype of the R6/2 mouse model of Huntington's disease.
22652528 2012 Tissue transglutaminase (TG-2) modified amniotic membrane: a novel scaffold for biomedical applications.
22493284 2012 Ataxia-Telangiectasia, Mutated (ATM)/Nuclear Factor ? light chain enhancer of activated B cells (NF?B) signaling controls basal and DNA damage-induced transglutaminase 2 expression.
22460364 2013 ?-Tocopherol inhibits human prostate cancer cell proliferation by up-regulation of transglutaminase 2 and down-regulation of cyclins.
22458929 2012 Expression TGM2 and BNIP3 have prognostic significance in laryngeal cancer patients receiving surgery and postoperative radiotherapy: a retrospective study.
22451718 2012 Transglutaminase is essential for IgA nephropathy development acting through IgA receptors.
22442151 2012 Transglutaminase-2 interaction with heparin: identification of a heparin binding site that regulates cell adhesion to fibronectin-transglutaminase-2 matrix.
22418443 2012 Transglutaminase 2 promotes both caspase-dependent and caspase-independent apoptotic cell death via the calpain/Bax protein signaling pathway.
22385244 2012 Transglutaminase 2 expression is enhanced synergistically by interferon-? and tumour necrosis factor-? in human small intestine.
22382775 2013 Transglutaminase 2 transamidation activity during first-phase insulin secretion: natural substrates in INS-1E.
22366952 2012 High abundance of plasma cells secreting transglutaminase 2-specific IgA autoantibodies with limited somatic hypermutation in celiac disease intestinal lesions.
22364871 2012 Cellular functions of tissue transglutaminase.
22326684 2012 The function of tissue transglutaminase in celiac disease.
22320917 2012 Regulation of transglutaminase-mediated hepatic cell death in alcoholic steatohepatitis and non-alcoholic steatohepatitis.
22298777 2012 Characterization of heparin-binding site of tissue transglutaminase: its importance in cell surface targeting, matrix deposition, and cell signaling.
22231926 2013 The role of TG2 in ECV304-related vasculogenic mimicry.
22228808 2012 Interferon-? activates transglutaminase 2 via a phosphatidylinositol-3-kinase-dependent pathway: implications for celiac sprue therapy.
22225906 2012 Evidence that GTP-binding domain but not catalytic domain of transglutaminase 2 is essential for epithelial-to-mesenchymal transition in mammary epithelial cells.
22220479 2011 Transglutaminase-mediated remodeling of the human erythrocyte membrane skeleton: relevance for erythrocyte diseases with shortened cell lifespan.
22220477 2011 Transglutaminase 2 dysfunctions in the development of autoimmune disorders: celiac disease and TG2-/- mouse.
22220476 2011 Tissue transglutaminase and its role in human cancer progression.
22220475 2011 Transglutaminase 2 at the crossroads between cell death and survival.
22220474 2011 Transglutaminase 2: a new paradigm for NF-kappaB involvement in disease.
22220472 2011 Physiopathological roles of human transglutaminase 2.
22220471 2011 Structure and regulation of type 2 transglutaminase in relation to its physiological functions and pathological roles.
22198767 2012 A single conformational transglutaminase 2 epitope contributed by three domains is critical for celiac antibody binding and effects.
22160262 2013 Polymorphism of transglutaminase 2: unusually low frequency of genomic variants with deficient functions.
22139411 2013 Transglutaminase 2 as a biomarker of osteoarthritis: an update.
22130737 2013 Tissue transglutaminase: a new target to reverse cancer drug resistance.
22089883 2013 Expression of transglutaminase-2 isoforms in normal human tissues and cancer cell lines: dysregulation of alternative splicing in cancer.
22086212 2013 The side chain of glutamine 13 is the acyl-donor amino acid modified by type 2 transglutaminase in subunit T of the native rabbit skeletal muscle troponin complex.
22083892 2013 Tissue transglutaminase, inflammation, and cancer: how intimate is the relationship?
22080209 2013 Identification of human salivary transglutaminases.
22038180 2013 Anti-tissue transglutaminase antibodies activate intracellular tissue transglutaminase by modulating cytosolic Ca2+ homeostasis.
21984378 2013 Nitric oxide regulates tissue transglutaminase localization and function in the vasculature.
21971542 2011 Tissue transglutaminase antibodies in celiac disease: focus on the pediatric population.
21967801 2011 Transglutaminase 2 facilitates the distant hematogenous metastasis of breast cancer by modulating interleukin-6 in cancer cells.
21963846 2012 Tissue transglutaminase links TGF-?, epithelial to mesenchymal transition and a stem cell phenotype in ovarian cancer.
21943122 2011 Transglutaminase 2 as an independent prognostic marker for survival of patients with non-adenocarcinoma subtype of non-small cell lung cancer.
21935707 2013 Transglutaminase 2 interaction with small heat shock proteins mediate cell survival upon excitotoxic stress.
21908620 2011 Activation of extracellular transglutaminase 2 by thioredoxin.
21840417 2011 Novel participation of transglutaminase-2 through c-Jun N-terminal kinase activation in sphingosylphosphorylcholine-induced keratin reorganization of PANC-1 cells.
21830119 2012 Transglutaminase 2 is secreted from smooth muscle cells by transamidation-dependent microparticle formation.
21818567 2012 TG2, a novel extracellular protein with multiple functions.
21777419 2011 Role of tissue transglutaminase 2 in the acquisition of a mesenchymal-like phenotype in highly invasive A431 tumor cells.
21757696 2011 Reactivity of the N-terminal region of fibronectin protein to transglutaminase 2 and factor XIIIA.
21678409 2012 Interplay between membrane lipid peroxidation, transglutaminase activity, and cyclooxygenase 2 expression in the tissue adjoining to breast cancer.
21625219 2011 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking.
21525012 2011 Epidermal growth factor receptor-mediated tissue transglutaminase overexpression couples acquired tumor necrosis factor-related apoptosis-inducing ligand resistance and migration through c-FLIP and MMP-9 proteins in lung cancer cells.
21441900 2011 Role and predictive strength of transglutaminase type 2 expression in premalignant lesions of the cervix.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21359202 2011 Aberrant DNA methylation of matrix remodeling and cell adhesion related genes in pterygium.
21304968 2011 Cytosolic guanine nucledotide binding deficient form of transglutaminase 2 (R580a) potentiates cell death in oxygen glucose deprivation.
21269460 2011 Initial characterization of the human central proteome.
21226238 2011 Role of transglutaminase 2 in apoptosis induced by hydrogen peroxide in human chondrocytes.
21129482 Transglutaminase 2 regulates early chondrogenesis and glycosaminoglycan synthesis.
21124911 2010 The preferred substrates for transglutaminase 2 in a complex wheat gluten digest are Peptide fragments harboring celiac disease T-cell epitopes.
21036738 2010 Up-regulation of fibronectin and tissue transglutaminase promotes cell invasion involving increased association with integrin and MMP expression in A431 cells.
21036168 2011 Importance of syndecan-4 and syndecan -2 in osteoblast cell adhesion and survival mediated by a tissue transglutaminase-fibronectin complex.
20967228 2010 Tissue transglutaminase promotes drug resistance and invasion by inducing mesenchymal transition in mammary epithelial cells.
20929862 2010 RGD-independent cell adhesion via a tissue transglutaminase-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 ?5?1 integrin co-signaling.
20926141 2011 The functional significance of the TGM2 gene in schizophrenia: a correlation of SNPs and circulating IL-2 levels.
20874003 2011 Clinical significance of GPR56, transglutaminase 2, and NF-?B in esophageal squamous cell carcinoma.
20739659 2010 Tissue transglutaminase contributes to the all-trans-retinoic acid-induced differentiation syndrome phenotype in the NB4 model of acute promyelocytic leukemia.
20731658 2011 Appearance of tissue transglutaminase in astrocytes in multiple sclerosis lesions: a role in cell adhesion and migration?
20731657 2011 Presence of tissue transglutaminase in granular endoplasmic reticulum is characteristic of melanized neurons in Parkinson's disease brain.
20717931 2011 Hyperosmolarity-mediated mitochondrial dysfunction requires Transglutaminase-2 in human corneal epithelial cells.
20676023 2010 Transglutaminase 2 inhibits apoptosis induced by calcium- overload through down-regulation of Bax.
20659425 2010 I-kappaBalpha depletion by transglutaminase 2 and mu-calpain occurs in parallel with the ubiquitin-proteasome pathway.
20615646 2010 Activation of transglutaminase type 2 for aortic wall protection in a rat abdominal aortic aneurysm formation.
20596752 2011 The transglutaminase 2 gene is aberrantly hypermethylated in glioma.
20547769 2010 Redox regulation of transglutaminase 2 activity.
20489165 2010 Decreased S-nitrosylation of tissue transglutaminase contributes to age-related increases in vascular stiffness.
20488756 2010 Coeliac disease autoantibodies mediate significant inhibition of tissue transglutaminase.
20450932 2010 Crystal structure of human transglutaminase 2 in complex with adenosine triphosphate.
20450916 2010 Inhibition of tissue transglutaminase sensitizes TRAIL-resistant lung cancer cells through upregulation of death receptor 5.
20437185 2010 Transglutaminase 2 silencing reduced the beta-amyloid-effects on the activation of human THP-1 cells.
20371597 2010 Characterization of transglutaminase type II role in dendritic cell differentiation and function.
20156196 2010 Transglutaminase-2: a new endostatin partner in the extracellular matrix of endothelial cells.
20080707 2010 EGF potentiated oncogenesis requires a tissue transglutaminase-dependent signaling pathway leading to Src activation.
20052409 2010 Transglutaminase 2, a novel regulator of eicosanoid production in asthma revealed by genome-wide expression profiling of distinct asthma phenotypes.
20033322 2010 TGM2 is a novel marker for prognosis and therapeutic target in colorectal cancer.
20007697 2010 Opposing effects of two tissue transglutaminase protein isoforms in neuroblastoma cell differentiation.
19937343 2010 Tissue transglutaminase 2 as a biomarker of cervical intraepithelial neoplasia (CIN) and its relationship to p16INK4A and nuclear factor kappaB expression.
19931242 2010 The interaction of angiocidin with tissue transglutaminase.
19912255 2010 Anti-transglutaminase antibodies in non-coeliac children suffering from infectious diseases.
19878304 2009 Functional significance of five noncanonical Ca2+-binding sites of human transglutaminase 2 characterized by site-directed mutagenesis.
19840940 2009 Transglutaminase 2 regulates the GTPase-activating activity of Bcr.
19838207 2010 Transglutaminase 2 suppresses apoptosis by modulating caspase 3 and NF-kappaB activity in hypoxic tumor cells.
19756726 2009 Tissue transglutaminase expression in celiac mucosa: an immunohistochemical study.
19738201 2009 Proteomic analysis of integrin-associated complexes identifies RCC2 as a dual regulator of Rac1 and Arf6.
19680746 2009 Celiac disease IgA modulates vascular permeability in vitro through the activity of transglutaminase 2 and RhoA.
19657147 2009 Increased TG2 expression can result in induction of transforming growth factor beta1, causing increased synthesis and deposition of matrix proteins, which can be regulated by nitric oxide.
19655169 2010 The mechanism of transglutaminase 2 inhibition with glucosamine: implications of a possible anti-inflammatory effect through transglutaminase inhibition.
19632032 2010 Transglutaminase 2 expression levels regulate sensitivity to cystamine plus TRAIL-mediated apoptosis.
19628791 2009 Induction of transglutaminase 2 by a liver X receptor/retinoic acid receptor alpha pathway increases the clearance of apoptotic cells by human macrophages.
19625650 2009 SUMOylation of tissue transglutaminase as link between oxidative stress and inflammation.
19619546 2009 Transglutaminase 2 and nucleoside diphosphate kinase activity are correlated in epithelial membranes and are abnormal in cystic fibrosis.
19562471 2009 Tissue transglutaminase can be involved in airway inflammation of toluene diisocyanate-induced occupational asthma.
19542224 2009 The first draft of the endostatin interaction network.
19403524 2009 Tissue transglutaminase is an essential participant in the epidermal growth factor-stimulated signaling pathway leading to cancer cell migration and invasion.
19342211 2009 Antigen presentation in celiac disease.
19324884 2009 Tissue transglutaminase regulates matrix metalloproteinase-2 in ovarian cancer by modulating cAMP-response element-binding protein activity.
19278990 2009 Transglutaminase-2 regulation by arecoline in gingival fibroblasts.
19183553 2009 Degradation of transglutaminase 2 by calcium-mediated ubiquitination responding to high oxidative stress.
19182256 2009 Exploring functional candidate genes for genetic association in german patients with pseudoexfoliation syndrome and pseudoexfoliation glaucoma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19013523 2009 Modulation of tissue transglutaminase in tubular epithelial cells alters extracellular matrix levels: a potential mechanism of tissue scarring.
18923241 2008 Increased tissue transglutaminase expression in human atherosclerotic coronary arteries.
18849643 2008 Application of a global proteomic approach to archival precursor lesions: deleted in malignant brain tumors 1 and tissue transglutaminase 2 are upregulated in pancreatic cancer precursors.
18809380 2008 Tissue transglutaminase-induced down-regulation of matrix metalloproteinase-9.
18804908 2009 Glucosamine is an effective chemo-sensitizer via transglutaminase 2 inhibition.
18793760 2008 The propensity for deamidation and transamidation of peptides by transglutaminase 2 is dependent on substrate affinity and reaction conditions.
18673368 2009 Transglutaminases and transglutaminase-catalyzed cross-links colocalize with the pathological lesions in Alzheimer's disease brain.
18667446 2008 Tissue transglutaminase protects epithelial ovarian cancer cells from cisplatin-induced apoptosis by promoting cell survival signaling.
18632639 2008 Clinical and biological significance of tissue transglutaminase in ovarian carcinoma.
18587533 2008 Tissue transgluaminase 2 expression in meningiomas.
18584285 2009 Transglutaminase-2 differently regulates cartilage destruction and osteophyte formation in a surgical model of osteoarthritis.
18561261 2009 The TGM2 gene is associated with schizophrenia in a British population.
18544639 2008 Factor XIIIA mobilizes transglutaminase 2 to induce chondrocyte hypertrophic differentiation.
18505736 2008 Tissue transglutaminase modulates alpha-synuclein oligomerization.
18499669 2008 Fibronectin-tissue transglutaminase matrix rescues RGD-impaired cell adhesion through syndecan-4 and beta1 integrin co-signaling.
18490773 2008 Tissue transglutaminase activation modulates inflammation in cystic fibrosis via PPARgamma down-regulation.
18474442 2008 Transglutaminase 2 activity promotes membrane resealing after mechanical damage in the lung cancer cell line A549.
18381937 2008 Tissue transglutaminase regulates focal adhesion kinase/AKT activation by modulating PTEN expression in pancreatic cancer cells.
18375543 2008 Transglutaminase 2 protects against ischemic insult, interacts with HIF1beta, and attenuates HIF1 signaling.
18353867 2008 TGFbeta mediates activation of transglutaminase 2 in response to oxidative stress that leads to protein aggregation.
18312620 2008 Secretion of celiac disease autoantibodies after in vitro gliadin challenge is dependent on small-bowel mucosal transglutaminase 2-specific IgA deposits.
18235007 2008 Tissue transglutaminase expression and activity in normal and glaucomatous human trabecular meshwork cells and tissues.
18174247 2008 The transglutaminase 2 gene (TGM2), a potential molecular marker for chemotherapeutic drug sensitivity, is epigenetically silenced in breast cancer.
18092889 2007 Transglutaminase 2 undergoes a large conformational change upon activation.
18052077 2007 GTP-binding-defective forms of tissue transglutaminase trigger cell death.
17939176 2007 Missense mutations in the TGM2 gene encoding transglutaminase 2 are found in patients with early-onset type 2 diabetes. Mutation in brief no. 982. Online.
17924658 2007 Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.
17890909 2007 Transglutaminases: the missing link in nephrogenic systemic fibrosis.
17762854 2008 Transglutaminase autoantibodies in dermatitis herpetiformis and celiac sprue.
17711877 2007 Cell-surface transglutaminase undergoes internalization and lysosomal degradation: an essential role for LRP1.
17671187 2007 Enhanced peritoneal ovarian tumor dissemination by tissue transglutaminase.
17625111 2007 A role for tissue transglutaminase in stabilization of membrane-cytoskeletal particles shed from the human placenta.
17609251 2007 Identification of two GTP-independent alternatively spliced forms of tissue transglutaminase in human leukocytes, vascular smooth muscle, and endothelial cells.
17476115 2007 Arterial vimentin is a transglutaminase substrate: a link between vasomotor activity and remodeling?
17442486 2007 Role of tissue transglutaminase type 2 in calbindin-D28k interaction with ataxin-1.
17440814 2007 Tissue transglutaminase induces the release of apoptosis inducing factor and results in apoptotic death of pancreatic cancer cells.
17403029 2007 Type 2 transglutaminase differentially modulates striatal cell death in the presence of wild type or mutant huntingtin.
17374730 2007 Tissue transglutaminase inhibits autophagy in pancreatic cancer cells.
17314516 2007 GPR56 and TG2: possible roles in suppression of tumor growth by the microenvironment.
17228174 2007 Involvement of transglutaminase-2 in pathological changes in renal disease.
17189522 2007 Osteopontin upregulation and polymerization by transglutaminase 2 in calcified arteries of Matrix Gla protein-deficient mice.
17171363 2007 Development of autoimmunity to transglutaminase C in children of patients with type 1 diabetes: relationship to islet autoantibodies and infant feeding.
17043648 2007 Tissue transglutaminase expression promotes cell attachment, invasion and survival in breast cancer cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16951195 2006 Overexpression of tissue transglutaminase leads to constitutive activation of nuclear factor-kappaB in cancer cells: delineation of a novel pathway.
16914140 2006 Complex formation between tissue transglutaminase II (tTG) and vascular endothelial growth factor receptor 2 (VEGFR-2): proposed mechanism for modulation of endothelial cell response to VEGF.
16826431 2006 Tissue array-based expression of transglutaminase-2 in human breast and ovarian cancer.
16757564 2006 GPR56, an atypical G protein-coupled receptor, binds tissue transglutaminase, TG2, and inhibits melanoma tumor growth and metastasis.
16720350 2006 Changes in gene expression with increased transglutaminase 2 in a SH-SY5Y cell line.
16522628 2006 Mutation of a critical arginine in the GTP-binding site of transglutaminase 2 disinhibits intracellular cross-linking activity.
16449978 2006 Implications of increased tissue transglutaminase (TG2) expression in drug-resistant breast cancer (MCF-7) cells.
16439457 2006 Identification of a signaling pathway involving progesterone receptor, calcitonin, and tissue tranglutaminase in Ishikawa endometrial cells.
16407273 2006 Phosphorylation of histones by tissue transglutaminase.
16382148 2006 Tissue transglutaminase serves as an inhibitor of apoptosis by cross-linking caspase 3 in thapsigargin-treated cells.
16368554 2006 The role of transglutaminase-2 and its substrates in human diseases.
16368540 2006 Transglutaminases in mineralized tissues.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16338459 Tissue transglutaminase expression and activity in placenta.
16313886 2006 The p53 oncoprotein is a substrate for tissue transglutaminase kinase activity.
16301118 Tissue transglutaminase interacts with protein kinase A anchor protein 13 in prostate cancer.
16300411 2005 Elafin and its precursor trappin-2 still inhibit neutrophil serine proteinases when they are covalently bound to extracellular matrix proteins by tissue transglutaminase.
16285941 2005 Unexpected role of surface transglutaminase type II in celiac disease.
16153302 2005 Tissue transglutaminase-induced alterations in extracellular matrix inhibit tumor invasion.
16146777 2006 Tissue transglutaminase (TG2)--a wound response enzyme.
16146727 2006 Role of protein modifications mediated by transglutaminase 2 in human viral diseases.
16146723 2006 Tissue transglutaminase: from biological glue to cell survival cues.
15886239 2005 Tissue transglutaminase at embryo-maternal interface.
15752564 2005 Can tissue transglutaminase be a marker of idiopathic inflammatory myopathies?
15746535 2005 Tissue transglutaminase and celiac disease.
15715085 2005 Mutant huntingtin protein: a substrate for transglutaminase 1, 2, and 3.
15691824 2005 External GTP-bound transglutaminase 2 is a molecular switch for chondrocyte hypertrophic differentiation and calcification.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15585642 2004 Prognostic significance of tissue transglutaminase in drug resistant and metastatic breast cancer.
15556610 2004 Overexpression of transglutaminase 2 accelerates the erythroid differentiation of human chronic myelogenous leukemia K562 cell line through PI3K/Akt signaling pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471861 2004 Transglutaminase 2 induces nuclear factor-kappaB activation via a novel pathway in BV-2 microglia.
15460447 2004 Tissue transglutaminase is not involved in the aggregate formation of stably expressed alpha-synuclein in SH-SY5Y human neuroblastoma cells.
15362860 2004 Cell-surface-associated tissue transglutaminase is a target of MMP-2 proteolysis.
15272014 2004 Augmentation of tissue transglutaminase expression and activation by epidermal growth factor inhibit doxorubicin-induced apoptosis in human breast cancer cells.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15220331 2004 Alpha1B-adrenoceptor signaling and cell motility: GTPase function of Gh/transglutaminase 2 inhibits cell migration through interaction with cytoplasmic tail of integrin alpha subunits.
15201665 2004 Tissue transglutaminase: a mediator and predictor of chronic allograft nephropathy?
15199098 2004 Crosslinking and G-protein functions of transglutaminase 2 contribute differentially to fibroblast wound healing responses.
15069073 2004 Tissue transglutaminase has intrinsic kinase activity: identification of transglutaminase 2 as an insulin-like growth factor-binding protein-3 kinase.
15001552 2004 Tissue transglutaminase catalyzes the formation of alpha-synuclein crosslinks in Parkinson's disease.
14985437 2004 Calmodulin regulates transglutaminase 2 cross-linking of huntingtin.
14752105 2004 Cell type-specific activation of intracellular transglutaminase 2 by oxidative stress or ultraviolet irradiation: implications of transglutaminase 2 in age-related cataractogenesis.
14747475 2004 Molecular characterization of covalent complexes between tissue transglutaminase and gliadin peptides.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14631123 2004 Increase in transglutaminase 2 in idiopathic inflammatory myopathies.
14517264 2003 Transglutaminase 2 inhibits Rb binding of human papillomavirus E7 by incorporating polyamine.
12960346 2003 Identification of tissue transglutaminase as a novel molecule involved in human CD8+ T cell transendothelial migration.
12853457 2003 Characterization of periphilin, a widespread, highly insoluble nuclear protein and potential constituent of the keratinocyte cornified envelope.
12743114 2003 Tissue transglutaminase directly regulates adenylyl cyclase resulting in enhanced cAMP-response element-binding protein (CREB) activation.
12698366 2003 Immunohistochemical study of the apoptotic mechanisms in the intestinal mucosa during children's coeliac disease.
12528814 2003 Transglutaminase cross-links in intranuclear inclusions in Huntington disease.
12527383 2003 Differential incorporation of biotinylated polyamines by transglutaminase 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438565 2002 Trifunctional chemical probes for the consolidated detection and identification of enzyme activities from complex proteomes.
12410804 2002 Transforming growth factor-beta (TGF-beta) and tissue transglutaminase expression in the small intestine in children with coeliac disease.
12387450 2002 Abnormal accumulation of tTGase products in muscle and erythrocytes of chorea-acanthocytosis patients.
12368090 2002 Transglutaminase 2: an enigmatic enzyme with diverse functions.
12205028 2002 Role of transglutaminase 2 in glucose tolerance: knockout mice studies and a putative mutation in a MODY patient.
12093810 2002 Gliadin T cell epitope selection by tissue transglutaminase in celiac disease. Role of enzyme specificity and pH influence on the transamidation versus deamidation process.
12061780 2002 GTP is required to stabilize and display transamidation activity of transglutaminase 2.
11867764 2002 Conserved tryptophan in the core domain of transglutaminase is essential for catalytic activity.
11867708 2002 Structural basis for the guanine nucleotide-binding activity of tissue transglutaminase and its regulation of transamidation activity.
11829448 2002 Involvement of tissue transglutaminase in the stabilisation of biomaterial/tissue interfaces important in medical devices.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11762979 2001 "Tissue" transglutaminase expression in HIV-infected cells: an enzyme with an antiviral effect?
11742196 2001 Germline mutations in TGM2 do not contribute to coeliac disease susceptibility in the Swedish population.
11686302 2001 Cell-surface transglutaminase promotes fibronectin assembly via interaction with the gelatin-binding domain of fibronectin: a role in TGFbeta-dependent matrix deposition.
11442349 2001 Tissue transglutaminase selectively modifies proteins associated with truncated mutant huntingtin in intact cells.
11390390 2001 Evolution of transglutaminase genes: identification of a transglutaminase gene cluster on human chromosome 15q15. Structure of the gene encoding transglutaminase X and a novel gene family member, transglutaminase Z.
11350930 2001 Role of transglutaminase II in retinoic acid-induced activation of RhoA-associated kinase-2.
11258932 2001 S100A7, S100A10, and S100A11 are transglutaminase substrates.
11013236 2001 Intron-exon swapping of transglutaminase mRNA and neuronal Tau aggregation in Alzheimer's disease.
10963790 2000 alpha(2)-plasmin inhibitor is a substrate for tissue transglutaminase: an in vitro study.
10958788 2000 Cross-linking of wild-type and mutant alpha 2-antiplasmins to fibrin by activated factor XIII and by a tissue transglutaminase.
10922377 2000 The mixed lineage kinase DLK is oligomerized by tissue transglutaminase during apoptosis.
10684262 2000 Tissue transglutaminase is an integrin-binding adhesion coreceptor for fibronectin.
10611475 1999 Thymosin beta(4) serves as a glutaminyl substrate of transglutaminase. Labeling with fluorescent dansylcadaverine does not abolish interaction with G-actin.
10561600 1999 Conformational stability of human erythrocyte transglutaminase. Patterns of thermal unfolding at acid and alkaline pH.
10556977 1999 Tissue transglutaminase is a caspase substrate during apoptosis. Cleavage causes loss of transamidating function and is a biochemical marker of caspase 3 activation.
10521459 1999 Cell surface localization of tissue transglutaminase is dependent on a fibronectin-binding site in its N-terminal beta-sandwich domain.
10518533 1999 Interactions of G(h)/transglutaminase with phospholipase Cdelta1 and with GTP.
10100610 1999 Interaction of tissue transglutaminase with nuclear transport protein importin-alpha3.
9973324 1999 Identification of 'tissue' transglutaminase binding proteins in neural cells committed to apoptosis.
9512491 1998 Phospholipase C-delta1 and oxytocin receptor signalling: evidence of its role as an effector.
9442029 1998 Identification of the eukaryotic initiation factor 5A as a retinoic acid-stimulated cellular binding partner for tissue transglutaminase II.
9315663 1997 Tissue transglutaminase-dependent posttranslational modification of the retinoblastoma gene product in promonocytic cells undergoing apoptosis.
9252372 1997 Identification of cytoplasmic actin as an abundant glutaminyl substrate for tissue transglutaminase in HL-60 and U937 cells undergoing apoptosis.
9060478 1997 Latent transforming growth factor-beta binding protein domains involved in activation and transglutaminase-dependent cross-linking of latent transforming growth factor-beta.
8611626 1996 A third human tissue transglutaminase homologue as a result of alternative gene transcripts.
8105889 1993 Keratinocyte transglutaminase membrane anchorage: analysis of site-directed mutants.
7912692 1994 The human tissue transglutaminase gene maps on chromosome 20q12 by in situ fluorescence hybridization.
7730416 1995 Transglutaminase-catalyzed matrix cross-linking in differentiating cartilage: identification of osteonectin as a major glutaminyl substrate.
2578891 1985 Keratinocyte-specific transglutaminase of cultured human epidermal cells: relation to cross-linked envelope formation and terminal differentiation.
1670773 1991 Calcium-induced intracellular cross-linking of lipocortin I by tissue transglutaminase in A431 cells. Augmentation by membrane phospholipids.
1670766 1991 Isolation and characterization of cDNA clones to mouse macrophage and human endothelial cell tissue transglutaminases.
1358880 1992 A retinoic acid-inducible mRNA from human erythroleukemia cells encodes a novel tissue transglutaminase homologue.
1353685 1992 Identification of transglutaminase substrates in HT29 colon cancer cells: use of 5-(biotinamido)pentylamine as a transglutaminase-specific probe.