Property Summary

Ligand Count 157
NCBI Gene PubMed Count 376
PubMed Score 1602.31
PubTator Score 1720.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis 1.461 4.6e-02
atypical teratoid/rhabdoid tumor -1.100 8.0e-04
Breast cancer 1.400 3.1e-06
COPD -1.500 2.7e-03
cutaneous lupus erythematosus 2.600 3.1e-04
cystic fibrosis 2.088 1.1e-06
group 4 medulloblastoma -1.500 9.7e-04
interstitial cystitis 1.400 3.5e-02
intraductal papillary-mucinous adenoma (... -3.100 9.6e-05
intraductal papillary-mucinous carcinoma... -2.100 1.3e-02
invasive ductal carcinoma 1.600 5.5e-03
lung adenocarcinoma -1.700 5.2e-07
lung cancer -2.200 1.7e-04
lung carcinoma -3.400 7.0e-41
malignant mesothelioma -1.900 4.7e-07
medulloblastoma, large-cell -1.500 2.1e-03
mucosa-associated lymphoid tissue lympho... 1.878 1.2e-02
non-small cell lung cancer -1.447 6.2e-10
osteosarcoma -1.681 3.1e-02
ovarian cancer 1.500 5.4e-03
pancreatic cancer 1.200 6.6e-03
pituitary cancer -2.700 3.8e-09
primary pancreatic ductal adenocarcinoma 2.087 3.5e-04
pterygium -1.300 1.2e-02

Gene RIF (332)

AA Sequence

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQE      1 - 70
AGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFN     71 - 140
AWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRD    141 - 210
CSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVF    211 - 280
AAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPG    281 - 350
YEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL    351 - 420
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFD    421 - 490
VFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEKYRDCLTESNL    491 - 560
IKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLT    561 - 630
EEQKTVEIPDPVEAGEEVKVRMDLLPLHMGLHKLVVNFESDKLKAVKGFRNVIIGPA                 631 - 687
//

Text Mined References (382)

PMID Year Title