Property Summary

NCBI Gene PubMed Count 24
PubMed Score 15.42
PubTator Score 16.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 2.500 9.7e-08
psoriasis -2.000 9.2e-04
osteosarcoma -1.349 6.9e-05
ependymoma 1.900 9.7e-09
glioblastoma 1.600 2.5e-03
sonic hedgehog group medulloblastoma 2.800 7.3e-09
atypical teratoid/rhabdoid tumor 2.700 9.4e-09
medulloblastoma, large-cell 1.800 2.0e-03
primitive neuroectodermal tumor 1.800 1.4e-04
pediatric high grade glioma 1.600 1.4e-04

Protein-protein Interaction (1)

Gene RIF (4)

PMID Text
26638007 expression of miR-148a was regulated by DNA methylation and targeted by TGIF2. Its methylation may be a potential prognostic indicator in skin cancer
26464633 miR-34a could inhibit tumor invasion and metastasis in gastric cancer by targeting Tgif2
26330748 Corneal fibroblasts demonstrate the expression of TGIF1 and TGIF2 transcription factors. These transcriptional repressors are critical, at least partially, in mediating the antifibrotic effect of vorinostat in the cornea.
20040491 Shows that the homologous mouse Tgif2 gene is necessary for gastrulation.

AA Sequence

MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI      1 - 70
NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE     71 - 140
KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA    141 - 210
EMELQKQQDPSLPLLHTPIPLVSENPQ                                               211 - 237
//

Text Mined References (24)

PMID Year Title
26638007 2015 Down-Regulation of miR-148a Promotes Metastasis by DNA Methylation and is Associated with Prognosis of Skin Cancer by Targeting TGIF2.
26464633 2015 MicroRNA-34a inhibits tumor invasion and metastasis in gastric cancer by targeting Tgif2.
26330748 2015 Role of 5'TG3'-interacting factors (TGIFs) in Vorinostat (HDAC inhibitor)-mediated Corneal Fibrosis Inhibition.
22783022 2012 The Sin3a repressor complex is a master regulator of STAT transcriptional activity.
20040491 2010 Tgif1 and Tgif2 regulate Nodal signaling and are required for gastrulation.
19086843 2008 Identification of microRNAs caused by DNA methylation that induce metastasis.
18959792 2008 Integrating chromosomal aberrations and gene expression profiles to dissect rectal tumorigenesis.
18768788 2008 A microRNA DNA methylation signature for human cancer metastasis.
18094028 2008 The Gata5 target, TGIF2, defines the pancreatic region by modulating BMP signals within the endoderm.
16962354 2007 Functional analysis of mutations in TGIF associated with holoprosencephaly.
16534781 2006 TGIF, a gene associated with human brain defects, regulates neuronal development.
16436215 2006 The Tgif2 gene contains a retained intron within the coding sequence.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15880741 2005 Amplification and overexpression of aurora kinase A (AURKA) in immortalized human ovarian epithelial (HOSE) cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417041 2002 Differentially regulated genes as putative targets of amplifications at 20q in ovarian cancers.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11427533 2001 TGIF2 interacts with histone deacetylase 1 and represses transcription.
11006116 2000 Amplification and overexpression of TGIF2, a novel homeobox gene of the TALE superclass, in ovarian cancer cell lines.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.