Tbio | Homeobox protein TGIF1 |
Binds to a retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE). Inhibits the 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element. Active transcriptional corepressor of SMAD2. Links the nodal signaling pathway to the bifurcation of the forebrain and the establishment of ventral midline structures. May participate in the transmission of nuclear signals during development and in the adult, as illustrated by the down-modulation of the RXR alpha activities.
The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2013]
The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2013]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Holoprosencephaly | 56 | 5.693 | 2.8 |
Holoprosencephaly 4 | 1 | 0.0 | 0.0 |
Neoplasm Invasiveness | 161 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
astrocytoma | 1146 | 6.8e-12 |
psoriasis | 6694 | 2.0e-09 |
atypical teratoid / rhabdoid tumor | 5112 | 3.2e-08 |
glioblastoma | 5792 | 1.0e-07 |
tuberculosis | 2010 | 1.0e-07 |
acute quadriplegic myopathy | 1158 | 1.1e-07 |
pituitary cancer | 1972 | 3.7e-06 |
pancreatic cancer | 2398 | 9.7e-06 |
ovarian cancer | 8520 | 4.3e-05 |
primitive neuroectodermal tumor | 3035 | 5.8e-05 |
Astrocytoma, Pilocytic | 3081 | 3.3e-04 |
lung adenocarcinoma | 2716 | 6.5e-04 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 2.5e-03 |
adult high grade glioma | 3801 | 2.5e-03 |
lung cancer | 4740 | 4.1e-03 |
group 3 medulloblastoma | 4104 | 6.1e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.1e-02 |
Breast cancer | 3578 | 2.7e-02 |
pancreatic ductal adenocarcinoma liver metastasis | 1962 | 2.8e-02 |
ependymoma | 4679 | 2.9e-02 |
Disease | log2 FC | p |
---|---|---|
acute quadriplegic myopathy | 1.380 | 1.1e-07 |
adult high grade glioma | 1.600 | 2.5e-03 |
astrocytoma | 1.400 | 6.8e-12 |
Astrocytoma, Pilocytic | 1.300 | 3.3e-04 |
atypical teratoid / rhabdoid tumor | 2.800 | 3.2e-08 |
Breast cancer | 2.900 | 2.7e-02 |
ependymoma | 2.200 | 2.9e-02 |
glioblastoma | 2.100 | 1.0e-07 |
group 3 medulloblastoma | 1.800 | 6.1e-03 |
intraductal papillary-mucinous carcinoma... | 1.100 | 2.5e-03 |
intraductal papillary-mucinous neoplasm ... | 1.200 | 1.1e-02 |
lung adenocarcinoma | 1.100 | 6.5e-04 |
lung cancer | 1.500 | 4.1e-03 |
ovarian cancer | 2.000 | 4.3e-05 |
pancreatic cancer | 1.200 | 9.7e-06 |
pancreatic ductal adenocarcinoma liver m... | 1.489 | 2.8e-02 |
pituitary cancer | -2.500 | 3.7e-06 |
primitive neuroectodermal tumor | 2.200 | 5.8e-05 |
psoriasis | -1.100 | 2.0e-09 |
tuberculosis | -2.200 | 1.0e-07 |
MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYLPPAPWSSLAT 1 - 70 PSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWELPRSPSQGAQGPAPRRRLLETMKGIVAAS 71 - 140 GSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQ 141 - 210 VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPT 211 - 280 LGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCK 281 - 350 SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA 351 - 401 //