Property Summary

NCBI Gene PubMed Count 75
PubMed Score 31.84
PubTator Score 88.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
ependymoma 2.800 5.7e-19
astrocytoma 2.300 7.1e-03
glioblastoma 3.100 6.5e-04
sonic hedgehog group medulloblastoma 2.500 5.3e-06
atypical teratoid / rhabdoid tumor 2.800 3.2e-08
primitive neuroectodermal tumor 2.200 5.8e-05
acute quadriplegic myopathy 1.380 1.1e-07
tuberculosis -2.200 1.0e-07
pancreatic ductal adenocarcinoma liver m... 1.489 2.8e-02
intraductal papillary-mucinous carcinoma... 1.100 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.1e-02
lung cancer 1.500 4.1e-03
pancreatic cancer 1.200 9.7e-06
Breast cancer 2.900 2.7e-02
pediatric high grade glioma 2.300 7.7e-07
pilocytic astrocytoma 1.300 3.0e-04
lung adenocarcinoma 1.100 6.5e-04
psoriasis -1.100 2.0e-09
ovarian cancer 2.000 4.3e-05
pituitary cancer -2.500 3.7e-06

Protein-protein Interaction (1)

Gene RIF (48)

PMID Text
26330748 Corneal fibroblasts demonstrate the expression of TGIF1 and TGIF2 transcription factors. These transcriptional repressors are critical, at least partially, in mediating the antifibrotic effect of vorinostat in the cornea.
26104768 our study demonstrated the oncogenic role of TGIF1 in NSCLC, and TGIF1 might be a therapeutic target for non-small cell lung cancer .
26091794 Our results suggested that elevated expression of TGIF was involved in lung carcinogenesis.
25841779 c-Src/AKT is the upstream signaling that regulates TGIF-induced Nox4 activation and subsequent superoxide production.
25791921 TG-interacting factor transcriptionally induced by AKT/FOXO3A is a negative regulator that antagonizes arsenic trioxide-induced cancer cell apoptosis.
25537191 we suggest that TGIF plays an important role in low-dose arsenic-induced malignant transformation of HaCaT cells, which is regulated by c-Src/EGFR/AKT/FOXO3A pathway and redox signaling.
25349154 TGIF1 has a role as a negative regulator of MLL-rearranged acute myeloid leukemia
24478032 TG-interacting factor 1 (Tgif1) is an important repressor of SOAT2 gene expression.
24215395 TGIF1 is a relevant candidate gene with potential to contribute in the genesis of high myopia.
24119525 Alternative splicing of TGIF1 is deregulated in OSCC, with overexpression of some splicing variants, especially TGIF1v8, which is associated with advanced stages of OSCC.
23761267 Data demonstrate that homeobox gene TGIF-1 is a potential up-stream regulator of trophoblast differentiation and the altered TGIF-1 expression may contribute to aberrant villous trophoblast differentiation in FGR.
23476075 2 mutations in the holoprosencephaly (HPE)-related genes were detected (c.799 C>T, p.Q267X in TGIF gene and c.1279G>A, p.G427R in SHH gene) in 2 patients with pituitary stalk interruption syndrome (PSIS); data suggest HPE-related gene mutations are implicated in the etiolog of isolated pituitary defects
23019344 biochemical analysis of how to overcome TALE DNA binding domain sensitivity to cytosine methylation
22995913 TGIF1 plays a role in TNF-alpha- and radiation-induced inflammation and it could be a target in limiting this event in the vascular compartment
22771156 TGIF contributes to the progression of urothelial carcinoma via the phosphatidylinositol 3-kinase-AKT pathway.
22728270 TGIF can promote cellular migration/invasion activity of urothelial carcinoma cells.
22496059 Exclusion of mutations in TGIF gene in patients with the syndrome of frontonasal dysgenesis, callosal agenesis, basal encephalocele, and eye anomalies
22310223 Mutations in TGIF is associated with holoprosencephaly.
22293114 TGIF (TG-interacting factor) is an additional TALE superfamily member involved in the regulation of human SOX3 gene expression
21940735 There was a positive correlation between the severity of the brain malformation and facial features for SHH, SIX3, and TGIF, but no such correlation was found for ZIC2 mutations.
21577013 Longer survival was associated with hypomethylation at specific CpG sites (e.g. GREB1, TGIF and TOB1) and hypermethylation in other genes (e.g. TMCO5, PTPRN and GUCY2C).
21490324 The Smad corepressor transforming growth interacting factor was found to have flow-dependent nuclear localization
21237437 TGIF1 transcript signals were frequently intense in normal tissue, and generally weak in oral squamous cell carcinoma (OSCC), and stronger transcript signals in well-differentiated areas of OSCC when compared with poorly differentiated ones.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20622901 Cancer cell lines with inactivating mutations in Fbxw7 show enhanced levels of TGIF1 and attenuated TGFbeta-dependent signaling
20531442 The mutation percentage (24%) is comparable with previous reports, but we detected significantly less mutations in SHH and significantly more in SIX3. For TGIF1 and ZIC2 mutation the rate was in conformity with earlier reports
20064471 Data show that activation of TNF-alpha signaling induced the association of TGIF with Itch/AIP4, resulting in increased accessibility of cFlip(L) for association and ubiquitination by Itch/AIP4.
19699159 Data suggest that transforming growth-interacting factor (TGIF) has an important role myelopoiesis and may regulate the balance between proliferation and differentiation.
19524896 TGIF is a potential repressor of TGF-beta pathways in myometrial cells.
19060265 The study does not support the association of high myopia with alleles of rs2229336 in TGIF, rs3759223 in lumican, rs1982073 in TGFB1, and rs3735520 in HGF.
19060265 Observational study of gene-disease association. (HuGE Navigator)
18455519 A detailed description of the TGIF locus characterizing 12 TGIF splice isoforms.
18441095 TGIF is essential for EGF-mediated downregulation of tropoelastin expression
18172074 Observational study of gene-disease association. (HuGE Navigator)
18172074 Findings of this study suggest that the TGIF gene is unlikely to play a major role in either ocular biometric measures or refraction in a Caucasian population.
17825514 A Brazilian boy with lobar holoprosencephaly has a K44N mutation in the TGIF gene.
17440433 This results point to the possible involvement of TGIF in the pathophysiology of psychotic disorders in the CVCR population.
17158784 results reveal an important mechanism for the degradation of TGIF through the ubiquitin-proteasome pathway, whose deregulation might contribute to the development of human holoprosencephaly
17048038 Observational study of gene-disease association. (HuGE Navigator)
17048038 We found no statistical association between any of the 13 SNPs located on the TGIF gene and high myopia in Japanese subjects.
16962354 Of the eleven sequence variations in TGIF, all but four can be demonstrated to be functionally abnormal, associated with holoprosencephaly.
16916642 The interaction of TGIF with cPML through c-Jun may negatively regulate TGF-beta signaling through controlling the localization of cPML and, consequently, the assembly of the cPML-SARA complex.
16134180 Hypermethylation of cellular retinol-binding protein 1 is associated with gastric carcinogenesis
15223781 Mutation analysis of the encoded TGIF gene for MYP2 autosomal dominant high myopia did not identify sequence alterations associated with the disease phenotype.
12601022 TGIF is a probable candidate gene for high myopia.
12593671 TGF-beta affects the gene expression regulation of this protein in normal and tumor cell lines.
12522553 The first nonsense mutation and also a novel missense mutation identified in tgif gene is associated with holoprosencephaly
11810641 molecular analysis of holoprosencephaly identified a novel heterozygous missense TGIF mutation

AA Sequence

MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYLPPAPWSSLAT      1 - 70
PSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWELPRSPSQGAQGPAPRRRLLETMKGIVAAS     71 - 140
GSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQ    141 - 210
VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPT    211 - 280
LGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCK    281 - 350
SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA                       351 - 401
//

Text Mined References (76)

PMID Year Title
26330748 2015 Role of 5'TG3'-interacting factors (TGIFs) in Vorinostat (HDAC inhibitor)-mediated Corneal Fibrosis Inhibition.
26104768 2015 TGIF1 promoted the growth and migration of cancer cells in nonsmall cell lung cancer.
26091794 2015 Elevated expression of TGIF is involved in lung carcinogenesis.
25873176 2015 TGIF governs a feed-forward network that empowers Wnt signaling to drive mammary tumorigenesis.
25841779 2015 Transforming growth factor ?-interacting factor-induced malignant progression of hepatocellular carcinoma cells depends on superoxide production from Nox4.
25791921 2015 TG-interacting factor transcriptionally induced by AKT/FOXO3A is a negative regulator that antagonizes arsenic trioxide-induced cancer cell apoptosis.
25537191 2015 TG-interacting factor mediates arsenic-induced malignant transformation of keratinocytes via c-Src/EGFR/AKT/FOXO3A and redox signalings.
25416956 2014 A proteome-scale map of the human interactome network.
25349154 2015 TGIF1 is a negative regulator of MLL-rearranged acute myeloid leukemia.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24478032 2014 TG-interacting factor 1 acts as a transcriptional repressor of sterol O-acyltransferase 2.
24215395 2014 TGIF1 is a potential candidate gene for high myopia in ethnic Kashmiri population.
24119525 2013 TGIF1 splicing variant 8 is overexpressed in oral squamous cell carcinoma and is related to pathologic and clinical behavior.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23761267 2013 Homeobox gene transforming growth factor ?-induced factor-1 (TGIF-1) is a regulator of villous trophoblast differentiation and its expression is increased in human idiopathic fetal growth restriction.
23476075 2013 Pituitary stalk interruption syndrome and isolated pituitary hypoplasia may be caused by mutations in holoprosencephaly-related genes.
23019344 2012 Overcoming transcription activator-like effector (TALE) DNA binding domain sensitivity to cytosine methylation.
22995913 2012 The TG-interacting factor TGIF1 regulates stress-induced proinflammatory phenotype of endothelial cells.
22771156 2012 Overexpression of TG-interacting factor is associated with worse prognosis in upper urinary tract urothelial carcinoma.
22728270 2012 TG-interacting factor-induced superoxide production from NADPH oxidase contributes to the migration/invasion of urothelial carcinoma.
22496059 2012 Exclusion of mutations in TGIF, ALX3, and ALX4 genes in patients with the syndrome of frontonasal dysgenesis, callosal agenesis, basal encephalocele, and eye anomalies.
22310223 2012 Utilizing prospective sequence analysis of SHH, ZIC2, SIX3 and TGIF in holoprosencephaly probands to describe the parameters limiting the observed frequency of mutant gene×gene interactions.
22293114 2012 TG-interacting factor (TGIF) downregulates SOX3 gene expression in the NT2/D1 cell line.
21940735 2011 New findings for phenotype-genotype correlations in a large European series of holoprosencephaly cases.
21577013 2011 Progression-free survival in ovarian cancer is reflected in epigenetic DNA methylation profiles.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21490324 2011 Flow-dependent Smad2 phosphorylation and TGIF nuclear localization in human aortic endothelial cells.
21237437 2011 Detection of TGIF1 homeobox gene in oral squamous cell carcinoma according to histologic grading.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20622901 2010 Tumor suppressor Fbxw7 regulates TGF? signaling by targeting TGIF1 for degradation.
20531442 2010 The unfolding clinical spectrum of holoprosencephaly due to mutations in SHH, ZIC2, SIX3 and TGIF genes.
20064471 2009 A model of partnership co-opted by the homeodomain protein TGIF and the Itch/AIP4 ubiquitin ligase for effective execution of TNF-alpha cytotoxicity.
19699159 2009 Transforming growth-interacting factor (TGIF) regulates proliferation and differentiation of human myeloid leukemia cells.
19524896 2010 Transforming growth interacting factor expression in leiomyoma compared with myometrium.
19060265 2009 High myopia is not associated with the SNPs in the TGIF, lumican, TGFB1, and HGF genes.
18511908 2008 Identification of PCTA, a TGIF antagonist that promotes PML function in TGF-beta signalling.
18455519 2008 Genomic structure, alternative splicing and expression of TG-interacting factor, in human myeloid leukemia blasts and cell lines.
18441095 2008 EGF antagonizes TGF-beta-induced tropoelastin expression in lung fibroblasts via stabilization of Smad corepressor TGIF.
18172074 2008 Assessment of TGIF as a candidate gene for myopia.
17825514 2008 Variable phenotypic manifestations of a K44N mutation in the TGIF gene.
17440433 2007 TGFB-induced factor (TGIF): a candidate gene for psychosis on chromosome 18p.
17378698 2007 Prediction of graft-versus-host disease in humans by donor gene-expression profiling.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17158784 2007 A mechanism for mutational inactivation of the homeodomain protein TGIF in holoprosencephaly.
17048038 2006 Analysis of single nucleotide polymorphisms at 13 loci within the transforming growth factor-induced factor gene shows no association with high myopia in Japanese subjects.
16962354 2007 Functional analysis of mutations in TGIF associated with holoprosencephaly.
16916642 2006 Nuclear retention of the tumor suppressor cPML by the homeodomain protein TGIF restricts TGF-beta signaling.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
16323008 2006 Molecular evaluation of foetuses with holoprosencephaly shows high incidence of microdeletions in the HPE genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16134180 2005 DNA methylation of genes linked with retinoid signaling in gastric carcinoma: expression of the retinoid acid receptor beta, cellular retinol-binding protein 1, and tazarotene-induced gene 1 genes is associated with DNA methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15223781 2004 Sequence variants in the transforming growth beta-induced factor (TGIF) gene are not associated with high myopia.
15221788 2004 Molecular screening of SHH, ZIC2, SIX3, and TGIF genes in patients with features of holoprosencephaly spectrum: Mutation review and genotype-phenotype correlations.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601022 2003 TGFbeta-induced factor: a candidate gene for high myopia.
12593671 2003 Regulation of TG-interacting factor by transforming growth factor-beta.
12522553 2003 Molecular screening of the TGIF gene in holoprosencephaly: identification of two novel mutations.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11682623 2001 5'TG3' interacting factor interacts with Sin3A and represses AR-mediated transcription.
11571228 2001 The Smad transcriptional corepressor TGIF recruits mSin3.
11416139 2001 Inhibition of androgen receptor-mediated transcription by amino-terminal enhancer of split.
11371641 2001 c-Jun interacts with the corepressor TG-interacting factor (TGIF) to suppress Smad2 transcriptional activity.
11226163 2001 Epidermal growth factor signaling via Ras controls the Smad transcriptional co-repressor TGIF.
10995736 2000 The interaction of the carboxyl terminus-binding protein with the Smad corepressor TGIF is disrupted by a holoprosencephaly mutation in TGIF.
10835638 2000 Mutations in TGIF cause holoprosencephaly and link NODAL signalling to human neural axis determination.
10764806 2000 Three-amino acid extension loop homeodomain proteins Meis2 and TGIF differentially regulate transcription.
10199400 1999 A Smad transcriptional corepressor.
8537382 1995 A novel homeobox protein which recognizes a TGT core and functionally interferes with a retinoid-responsive motif.
7485158 1995 Physical mapping of the holoprosencephaly critical region in 18p11.3.
3192211 1988 Molecular detection of a Yp/18 translocation in a 45,X holoprosencephalic male.