Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.8e-13
Disease Target Count Z-score Confidence
Ganglioneuroblastoma 11 4.474 2.2
Ganglioneuroma 13 4.22 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 3.8e-13

Gene RIF (1)

AA Sequence

MGESAAATASLFQRRRRGRGGRVTFPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDT      1 - 70
EDVFPRRAGPLEVPADSRVFVQAALARPSPRWGLALHRCSVTPSSRPAPGPALALLREGCPADTSVAFPP     71 - 140
PPPPSPGAARPARFSFRLRPVFNASVQFLHCQLSRCRRLRGVRRAPAPLTPPPPPPPSRCLPQDEACADT    141 - 210
GSGSAEGLAADGPHLHTLTQPIVVTVPRPPPRPPKSVPGRAVRPEPPAPAPAALEPAPVVALVLAAFVLG    211 - 280
AALAAGLGLVCAHSAPHAPGPPARASPSGPQPRRSQ                                      281 - 316
//

Text Mined References (4)

PMID Year Title