Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.8e-13
Disease Target Count Z-score Confidence
Ganglioneuroblastoma 4 4.46 2.2
Ganglioneuroma 6 4.208 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 3.8e-13

AA Sequence

MGESAAATASLFQRRRRGRGGRVTFPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDT      1 - 70
EDVFPRRAGPLEVPADSRVFVQAALARPSPRWGLALHRCSVTPSSRPAPGPALALLREGCPADTSVAFPP     71 - 140
PPPPSPGAARPARFSFRLRPVFNASVQFLHCQLSRCRRLRGVRRAPAPLTPPPPPPPSRCLPQDEACADT    141 - 210
GSGSAEGLAADGPHLHTLTQPIVVTVPRPPPRPPKSVPGRAVRPEPPAPAPAALEPAPVVALVLAAFVLG    211 - 280
AALAAGLGLVCAHSAPHAPGPPARASPSGPQPRRSQ                                      281 - 316
//

Text Mined References (3)

PMID Year Title
15885500 2005 Discovery of 342 putative new genes from the analysis of 5'-end-sequenced full-length-enriched cDNA human transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.