Property Summary

NCBI Gene PubMed Count 404
PubMed Score 519.26
PubTator Score 615.96

Knowledge Summary

Patent (16,731)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Migraine 79 0.0 2.0
Vascular disease 281 0.0 2.0

Expression

  Differential Expression (32)

Disease log2 FC p
nephrosclerosis 1.026 1.1e-03
Waldenstrons macroglobulinemia 1.012 2.5e-02
malignant mesothelioma -2.000 3.5e-07
osteosarcoma 1.792 1.9e-04
posterior fossa group B ependymoma 1.200 2.4e-05
cystic fibrosis 2.945 6.3e-08
glioblastoma 2.400 1.1e-04
Duchenne muscular dystrophy 1.708 6.3e-08
autosomal dominant Emery-Dreifuss muscul... 1.333 7.1e-03
Becker muscular dystrophy 1.002 1.8e-02
juvenile dermatomyositis 1.484 9.4e-10
acute quadriplegic myopathy 1.507 8.5e-05
limb girdle muscular dystrophy 2A 1.190 2.3e-04
adrenocortical carcinoma -1.450 8.8e-04
pancreatic ductal adenocarcinoma liver m... -1.488 2.5e-02
non-small cell lung cancer -1.959 5.5e-21
lung cancer -3.600 6.0e-07
active ulcerative colitis 1.338 1.1e-02
breast carcinoma -1.400 1.5e-04
lung adenocarcinoma -2.100 1.1e-15
pediatric high grade glioma 1.200 7.4e-03
pilocytic astrocytoma 1.700 2.8e-07
sonic hedgehog group medulloblastoma 1.400 5.1e-04
Breast cancer -2.400 1.8e-15
COPD -1.100 6.2e-03
lung carcinoma -2.100 1.6e-21
mucosa-associated lymphoid tissue lympho... 1.018 3.3e-02
ductal carcinoma in situ -1.400 6.5e-04
invasive ductal carcinoma -2.200 1.7e-04
ovarian cancer -3.200 1.2e-09
Gaucher disease type 1 -2.300 1.7e-02
dermatomyositis 2.200 1.7e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (332)

PMID Text
27048361 This paper highlights that targeting the BMP and TGFbeta type I and type II receptors causes a downregulation of XIAP, TAK1, and Id1 leading to cell death of lung cancer cells.
26867007 AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells
26823785 results suggested that high CDKN1A/p21 and low TGFBR2 expression was closely correlated with adverse pathological parameters and poor prognosis in breast cancer.
26780887 Reduced expression of TGF-beta type II receptor and extracellular matrix components in response to reduced fibroblast size/mechanical force was fully reversed by restoring size/mechanical force
26652004 This work details a novel mechanism by which cellular tension regulates TGFbeta receptor organization, multimerization, and function.
26551005 High levels of TbetaRII expression were associated with lymph node metastasis, increasing tumor clinical stage, and poorer 5-year disease-free survival in patients with breast cancer. TbetaRII may be a potential prognostic marker for breast cancer.
26542979 MiR-1343 reduces the expression of both TGF-beta receptor 1 and 2 by directly targeting their 3'-UTRs.
26511382 TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26505114 Data (including data from studies in transgenic mice) suggest intraislet pancreatic duct cells are capable of giving rise to insulin-secreting beta-cells; Tgfbr2/transforming growth factor-beta type II receptor appears to involved in this process.
26498065 Findings suggest that the upregulation of miR-590-5p promotes cellular malignant behavior via the target gene TGFbetaRII in vulvar squamous cell carcinoma.
26356817 TGFBR2 is regulated by an epigenetic auto-feedback regulation in non-small cell lung cancer.
26301661 we reported a sporadic Japanese case of LDS with a novel TGFBR2 p.Y424H mutation, which appeared to cause pregnancy-related fatal aortic/arterial dissections.
26252213 TGFbetaR2 is a potential prognostic tumor biomarker for chemotherapy.
26169464 Case Report: endovascular repair of a left vertebral artery aneurysm in a patient with transforming growth factor beta receptor II mutation.
26168957 TGFbRII expression may be considered a new prognostic factor of diffuse large B cell lymphoma.
26115412 Ibeta3 co-localized with TGF-beta RII on rigid but not compliant films. Tumor-produced Ibeta3 plays a crucial role in disease progression. Rigid mineralized bone matrix can alter gene expression and bone destruction in an Ibeta3/TGF-beta-dependent manner.
26114631 Growth differentiation factor-15 (GDF-15) exhibited TGFBR2-dependent transcriptional upregulation causing increased intracellular and extracellular protein levels in colorectal carcinoma.
26078295 Depletion of IQGAP1 leads to increased TGFBR2 with TGFbeta signaling, explaining in part how reduced IQGAP1 promotes tumor growth
26073093 Studied folding and crystallization of the type II TGF-beta receptor extracellular domain using the non-detergent sulfobetaine-201, which acts as a pharmacological chaperone.
26037400 these results revealed no correlation between the normalized expression of TGF-beta2, TGF-betaRI, or TGF-betaRII and EDSS scores
26022443 TGFBR2 rs6785358 polymorphism contributes to congenital ventricular septal defect (CVSD) susceptibility, and the G allele may increase the risk of CVSD.
26017485 In sporadic AAA patients we found one pathogenic (TGFBR2 p.Ile525Phefs*18) and seven VUS
25928368 TGF-beta1 gene C509T polymorphism might be associated with decreased risk of lung adenocarcinoma in Chinese females exposed to cooking oil fumes, but no association was observed TGFBR2 gene G875A polymorphism
25882708 Our results show that LTBP4 interacts with TGFBR2 and stabilizes TGFbeta receptors by preventing their endocytosis and lysosomal degradation in a ligand-dependent and receptor kinase activity-dependent manner.
25849327 TGFBR2 variants may have prognostic and predictive value in ER-negative breast cancer patients treated with adjuvant chemotherapy.
25833830 Acquisition of low TGFBR2 expression is a contributing factor to endocrine resistance in breast cancer.
25826292 TGF-betaRII and its mRNA levels were lower in older women than in younger ones. Age affects TGF-beta signalling in leukocytes by altering the expression levels of its receptors.
25736321 TGFbeta signaling remains active in some MSI-H CRC cells despite the presence of frameshift mutations in the TGFBR2 gene because the mutated gene still expresses a functional protein.
25631750 these results suggest that simvastatin may inhibit A549 cell proliferation and downregulate TGF-betaRII expression by inhibiting activation of ERK.
25617554 Our result suggested that SNP rs6785358 of TGFBR2 gene was associated with increased risk of congenital heart defects in Han Chinese men
25551793 data indicated that miR-301a correlated with the metastatic and invasive ability in human colorectal cancers and miR-301a exerted its role as oncogene by targeting TGFBR2
25542272 A cytoplasmic predominant TGF-betaRII expression pattern and a higher pSmad2 expression were associated with decreased breast cancer survival.
25501507 Furthermore, downregulation of TGFbetaR2 by siRNA showed the same effects on the proliferation and apoptosis as miR-34a mimic in H1299 cells
25472963 The transcriptionl activation of TGFBR2 in CD8+ T lymphocytes is regulated by Kruppel-like factor, KLF10.
25443138 MicroRNA-19a enhances proliferation of bronchial epithelial cells by targeting TGFbetaR2 gene in severe asthma.
25374194 There is a possibility of TGFBR2 genetic polymorphism and the risk of cancer development.
25323858 Regulation of TGFBR2 expression is a direct target of miR145 in vascular smooth muscle cells.
25315765 Results show that metastatic differentiation and genetic heterogeneity of diffuse gastric cancer and reveal the potential metastatic role of TGFBR2 loss-of-function.
25234828 Identified a 137-bp region upstream of the transcriptional start site that exhibited high promoter activity and was repressed 60% by UV irradiation, where all other TbetaRII promoter constructs exhibited either low promoter activities or no regulation by UV.
25233932 we observed the coordinated loss of E-cadherin (CDH1) and transforming growth factor beta receptor II (TGFBR2) in esophageal squamous tumors.
25222187 Deep-sequencing of a primary tumor and metastasis from a single patient, and functional validation in culture, reveals that FGFR2 and TGFBR2 act as drivers of gastric cancer in primary and metastasis respectively.
25169976 PDGF receptor-alpha promotes TGF-beta signaling in hepatic stellate cells via transcriptional and posttranscriptional regulation of TGF-beta receptors.
24973511 The moderate overexpression of TGF-beta1 and TbetaRII mRNA in PTC tissues.
24846200 The TGFBR2 aberrant splicing was tumor-specific.
24793577 genetic testing revealed new mutations in FBN1, TGFbetaR1, TGFbetaR2 and ACTA2 detected in patients with clinical diagnosis of Marfan Syndrome, Loeys-Dietz Syndrome and Thoracic Aortic Aneurysms and Dissections.
24687999 Results suggest that TGFBR2 harbors variants that increase the risk of essential and affect blood pressure homeostasis as well as efficacy of antihypertensive agents in a Chinese population.
24606633 The present study reports an involvement of miR-93-mediated TGFbR2 down-regulation in NPC aggressiveness, thus giving extended insights into molecular mechanisms underlying cancer aggressiveness.
24597762 In cerebellar granule cells, TGFbetaRII activates the Akt/mTOR pathway which is mediated by GDF15 and Kv2.1.
24551192 Antibodies against TGF-beta or a TGF-beta receptor inhibitor SB431452 reverse HIV-1 Vpu-mediated profibrogenic activation of LX2 cells, suggesting that TGF-beta mediates these effects
24550076 Treatment with the anti-oxidant N-acetylcysteine reduces ROS elevation and normalizes TGF-beta signaling and target gene expression.
24447338 Antibodies against TGF-beta or a TGF-beta receptor inhibitor SB431452 reverse HIV-1 Vpu-mediated profibrogenic activation of LX2 cells, suggesting that TGF-beta mediates these effects
24443223 TGFb1 rs1800469 C>T polymorphism was significantly associated with decreased risk of conotruncal heart defects. TGFbetaR2 and VEGF polymorphisms may not play a role in the susceptibility of conotruncal heart defects.
24344637 TGFBR2 mutations in patients with dural ectasia in Loeys-Dietz syndrome
24336330 TGFBR2 expression in cancer-associated fibroblasts is associated with survival outcome in pre-menopausal breast cancer
24284203 these findings demonstrated that c/EBPalpha and c/EBPbeta determine the lineage commitment of hepatoblasts by negatively and positively regulating the expression of a common target gene, TGFBR2, respectively.
24279395 he expression of TGFbeta receptors (TGFbetaRI and TGFbetaRII) and FGF2 in the lens epithelium of the MCT mice was stronger than that of the wild-type ddY mice at 4 weeks and weaker than that of the wild-type ddY mice at 15 weeks after birth.
24243761 TGFBR1 and TGFBR2 mutations do not play a major role in isolated myxomatous valve dystrophy. Screening for FLNA mutations is recommended in familial myxomatous valvular dystrophy, particularly if X-linked inheritance is suspected.
24151081 This study suggests that miR-200b plays a tumour-promoting role by targeting CDKN1B (p27/kip1) in colorectal cancers.
24141771 Results show that epigenetic loss of TGFBR2 expression in prostatic fibroblasts, initiated by interactions with Prostate cancer results in the promoter methylation and silencing of DNA damage repair mediators.
24093773 The present study evaluated the serum levels of specific metalloproteinases (MMP-2 and MMP-9) and investigated the gene TGFBR in 28 patients with aortic valve disease associated with ascending aortic dilatation.
24037531 Results suggest that the AR and miR-21 axis exerts its oncogenic effects in prostate tumors by downregulating TGFBR2, hence inhibiting the tumor-suppressive activity of TGFbeta pathway.
24034922 The SNP (rs1495592) in TGFBR2 gene may not be associated with development of Kawasaki disease (KD)in children, but it is associated with Ccprpnary artery lesions in children with KD.
23970096 Mutation of TGF-beta receptor II facilitates human bladder cancer progression through altered TGF-beta1 signaling pathway.
23951322 The TGFBR2-875G>A contribution to an early relapse in androgen-deprivation therapy patients supports the involvement of TGFbeta1 pathway in castration-resistant prostate cancer.
23913824 oral cancers with TGFBR2 downregulation comprise a different group with more aggressive nature; TGFBR2 transcript levels may be developed as a promising prognostic biomarker
23899993 The elevated number of circulating regulatory T cells in patients with transient hypogammaglobulinemia of infancy is not associated with any abnormalities in the genes encoding the TGFBR1 or TGFBR2.
23883197 The synonymous single nucleotide polymorphism (rs2228048, Asn389Asn) of the TGFBR2 gene may be associated with development of acute rejection in Korean kidney transplantation recipients.
23750746 stress induced production of TGF-beta2 by BEC can modify liver allograft function by enhancing the de-differentiation of local epithelial cells.
23734265 Data indicate that the activation of MAPK and PI3K pathways resulted in TGF-beta1 signaling by down-regulating Nm23-H1 expression and up-regulating the expression of TbetaRI and TbetaRII, favoring further activation of multiple signaling pathways.
23726841 novel role for miR-211 in the regulation of TGFbetaRII and c-Myc during tumorigenesis being revealed should help to develop anti-head and neck squamous cell carcinoma therapies
23690952 ZEB1 and TGFBR2 identified as direct targets of miR-655
23548068 Variation in transforming growth factor beta receptor 2 tagged-SNP rs6550005 was associated with preeclampsia in white women while variation in rs6550005, rs1346907, and rs877572 was associated with preeclampsia in black women.
23454766 IQGAP1 in the tumor microenvironment suppresses TGFBR2 and TGF-beta dependent myofibroblastic differentiation to constrain tumor growth.
23395552 Data suggest miR-21 plays a critical role in the production of pro-inflammatory cytokines IFN-gamma and IL-17A in dnTGF-betaRII transgenic mice.
23312833 Case Report: treatment of aneurysms of the subclavian and vertebral arteries in Ehlers-Danlos syndrome with TGFBR2 mutation.
23290524 c-Cbl conjugates neural precursor cell-expressed, developmentally downregulated 8 (NEDD8), a ubiquitin-like protein, to TbetaRII at Lys556 and Lys567.
23248962 There may he abnormal gene expression of TbetaR II in pathological scar epidermis.
23228659 association of polymorphisms of the TGFBR2 gene with ossification of the posterior longitudinal ligament was confirmed in this study along with a novel unreported, nucleotide variation in intron 1
23220853 an association between TGF-betaRII-negative tumor and higher risk of metastasis to lungs and bones was verified.
23178117 MED12 is in part cytoplasmic where it negatively regulates TGF-betaR2 through physical interaction. MED12 suppression therefore results in activation of TGF-betaR signaling, which is both necessary and sufficient for drug resistance.
23157888 The SNP rs764522 of TGFBR2 is associated with increased risk of essential hypertension in the elderly Han Chinese population.
23099432 TGFbetaRIIb expression is a regulatory mechanism for TGFbeta2 signal transduction.
22972928 A transgenic model suggests a role for TGFBR2 signaling in dendritic cells (DCs) to prevent autoimmunity primarily through maintenance of DCs in their immature and tolerogenic state.
22912877 Data indicate that MiR-106a inhibits the expression of transforming growth factor-beta receptor 2 (TGFBR2), leading to increased colorectal cancer (CRC) cell migration and invasion.
22848678 a critical negative regulation level of TGF-beta signaling mediated by HILI (human PIWIL2) by its ability to interact with Hsp90 and promote TbetaR degradation
22739178 TGF-beta1 and its receptors including TGF-betaRI and TGF-betaRII are abnormally expressed in the peripheral blood of immune thrombocytopenic purpura patients.
22734312 We report a 13-year-old girl with Loeys-Dietz syndrome (LDS) caused by a known transforming growth factor beta receptor II (TGFBR2) gene mutation, who developed aortic root dilatation and saccular aneurysm of the internal carotid artery.
22684895 miR-590-5p promotes proliferation and invasion in human hepatocellular carcinoma cells by directly targeting TGF-beta RII. [mir-590-5p]
22672900 Data indicate that abrogation of TGFbeta signaling through introduction of a dominant negative TGFbeta receptor II (TGFbetaRII) in non-metastatic FETalpha colon cancer cells permits metastasis to distal organs, but does not reduce invasive behavior.
22651914 analysis of evolution of the TGF-beta superfamily and how they signal through a single pair of receptors, known as TbetaR-I and TbetaR-II [review]
22617150 TGF-beta family signaling through Smads is conceptually a simple and linear signaling pathway, driven by sequential phosphorylation, with type II receptors activating type I receptors, which in turn activate R-Smads [review]
22585622 Results demonstrate that HES (hairy and enhancer of split), the main transcription factor downstream of Notch, induces strong transactivation of TGF-ssRII by binding the TGF-betaRII promoter through its DNA-binding domain.
22571197 N-linked glycosylation is essentially required for the suGFccessful cell surface transportation of TGFbetaRII, suggesting a novel mechanism by which the TGF-beta sensitivity can be regulated by N-linked glycosylation levels of TGFbetaRII.
22539603 Single nucleotide polymorphism in TGFBR2 is associated with breast cancer.
22431140 TGFBR2 but not SPP1 genotype modulates osteopontin expression in Duchenne muscular dystrophy muscle.
22425785 The molecular mechanism that controls TssRII fate in IL-1ss treated cells, was investigated.
22399565 reduced TGF-beta-RII expression in human non-small cell lung cancer is a negative prognostic marker associated with more aggressive tumor behavior and worse clinical outcome
22391627 The abnormal expression of ALK1 and TGFbR2 were found to be independent contributors to nasopharyngeal carcinogenesis.
22314103 promoter methylation may exist in the early stage of esophageal squamous cell carcinoma and play important role in gene silencing
22310065 Report down-regulation of TGFBR2 in human abdominal aortic aneurysms.
22290546 the rs1805110T allele is associated with susceptibility to HBV-related hepatocellular carcinoma in males
22278155 Data suggest that TGF-beta, TGF-betaR1, TGF-betaR2, Smad4, pSmad2/3, and E-cadherin are closely related to tumor-node-metastasis (TNM) stage of colorectal cancer (CRC).
22259224 A novel missense TGFBR2 mutation p.V453E (c.1358T>A) in the proband and two relatives of a Chinese family is associated with a type 2 Marfan syndrome.
22095581 report on two LDS patients with mutations in TGFBR2. It appears that LDS can be associated with low bone mass and high bone turnover but increased matrix mineralization of trabecular bone
22093616 a novel gain-of-function TbetaRII mutation enhances TGF-beta signaling, leading to more invasive phenotypic changes in human OSCC
22072622 miR-21 plays an important role in regulating stemness by modulating TGFbetaR2 signaling in colon cancer cells.
22028617 Results suggest a mechanism for the downregulation of TbetaRII in lung cancer.
21978186 The evidence suggests that TGFBR1 and TGFBR2 are not susceptibility genes for intracranial aneurysm in this population
21949851 TGFBR2 mutations are not associated with the microsatellite instability-high colorectal cancer.
21924348 atypical protein kinase C isoforms regulate transforming growth factor beta (TGFB) signaling by altering cell surface TGFB receptor trafficking and degradation
21855067 This study suggests that two common genetic polymorphisms in TGFBR2 are associated with the risk of developing abdominal aortic aneurysm
21815248 TGFBR1, TGFBR2, and ACTA2 mutations were found in 4 families with thoracic aortic aneurysms and dissections and predominantly fusiform intracranial aneurysms.
21789464 in 4 families linkage with the FBN1 and TGFBR2 genes was excluded, and no mutations were identified in the coding region of TGFBR1, indicating the existence of other genes involved in Marfan syndrome.
21785915 TGFBR1 Int7G24A and TGFBR2 G-875A polymorphisms may play important roles in the risk of gastric cardia adenocarcinoma in North China.
21757750 Histone deacetylase inhibitor belinostat represses survivin expression through reactivation of transforming growth factor beta (TGFbeta) receptor II leading to cancer cell death
21737283 This study provided that TGFR-beta2-875 G/G genotype is a risk factor for brain arteriovenous malformation.
21725601 RNA interference (RNAi) technology was used to silence the expression of TGF-beta receptor, type II (TGFbetaRII) in the LAC cell line, A549, and its effects on cell proliferation, invasion and metastasis were examined.
21701930 Global comparison of gene expression profiles identified 2 striking differences in treated tumors relative to untreated tumors: a marked increase in IGBFP3 and concomitant decrease in TGFb-R2 gene and protein expression.
21666718 study concludes that miR-370 is a miRNA that is associated with GC progression by downregulating TGFbeta-RII
21609163 The synonymous SNP (rs2228048, Asn389Asn) of the TGFBR2 gene was found to be associated with the development of intracerebral hemorrhage in the South Korean population.
21454688 Restoration of transforming growth factor-beta receptor II expression in colon cancer cells with microsatellite instability increases metastatic potential in vivo
21423151 These results provide evidence that the two TbetaRI:TbetaRII heterodimers bind and mediate TGF-beta3 signalling.
21352603 The restoration of the expression of TbetaRII and TbetaRIII in oral cancerous tissues may represent a novel strategy for the treatment of oral carcinoma.
21324918 Case Report: Loeys-Dietz syndrome can result from TGF-bR2 mutations in the absence of obvious physical features and can exhibit a fulminant course.
21295082 CD109 regulates TGF-beta receptor endocytosis and degradation to inhibit TGF-beta signaling.
21270064 findings indicate that TGFBR2 gene mutations are responsible for sCAD in 3.6% (95% CI 0.0 to 8.4) of cases.
21249319 Expression of TssRII mRNA was significantly higher in clear cell adenocarcinoma and mucinous adenocarcinoma, while it was lower in serous adenocarcinoma and endometrioid adenocarcinoma.
21172820 TbetaRII alone is able to mediate TGFbeta signaling to ERK1/2 without participation of TbetaRI.
21170488 Studies indicate that endoglin (CD105) interacts with type I and type II TGF-beta receptors and modulates TGF-beta signaling.
21131601 Data suggest a novel mechanism for MEK1 in regulating the sensitivity to TGF-beta signaling by stabilizing TbetaRII.
21098638 The balance between defects in Smad and ERK signaling might be an important determinant of phenotypic severity in disorders related to mutations in TGFBR2.
20878063 The simultaneous expression of Endoglin (CD105), transforming growth factor (TGF)-beta1 and TGF-beta receptor (R) II were quantified in normal human colon, pre-malignant dysplastic tissue, and invasive colon cancer specimens
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20840324 TGFBRII protein expression in benign prostatic hyperplasia is associated with prostate gland volume and with CD4 T-lymphocyte prostatitis.
20805453 The TGFBR2 metagene(s) showed significant association with a better outcome in ER-positive breast tumors (without stratification by proliferative status) in two of the three data sets.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20701609 miR-21 expression in cord and increased TGFBR2 expression is associated with antenatal IgE production and development of allergic rhinitis
20662850 the connective tissue weakness does not relate to mutations in the genes FBN1, TGFBR1 and TGFBR2
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628007 TGFBR2 mutations alter smooth muscle cell phenotype and predispose to thoracic aortic aneurysms and dissections.
20628007 Observational study of gene-disease association. (HuGE Navigator)
20621662 Downregulation of TGF beta R-II expression by cigarette smoke-induced Egr-1 may contribute to smoking-induced premature skin aging.
20599261 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20565851 TGFbetaRII mutations are relatively late events in the genesis of colorectal cancer with microsatellite instability.
20518838 All 3 SNPs tested were significantly different between nonsegmental vitiligo patients & controls (rs2005061, rs3773645, & rs3773649). Haplotype 1 (CG) and haplotype 2 (GA) of the linkage disequilibrium block were associated with a risk of NSV.
20518838 Observational study of gene-disease association. (HuGE Navigator)
20457266 Observational study of gene-disease association. (HuGE Navigator)
20428796 The aim of this study was to investigate the effect of TGF-beta1 targeting by antisense oligonucleotides on the RNA synthesis and protein expression of TGF-beta isoforms and their receptors in keloid-derived fibroblasts.
20410122 Disruption of TGF-beta due to ttranscriptional dysregulation of TGF-beta receptor type II is associated with polyglutamine-induced motor neuron damage in spinal and bulbar muscular atrophy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374083 upregulation of the TGFbeta2 level is a common pathological feature of Alzheimer's disease (AD) brains and suggests that it may be closely linked to the development of neuronal death related to AD.
20358619 study presents 2 patients with Loeys-Dietz syndrome with significant skeletal fragility; one was heterozygous for a c.923T > C transition in exon 4 of TGFBR2; the other was heterozygous for a c.1561 T > C transition in exon 7 of TGFBR2
20237496 Observational study of gene-disease association. (HuGE Navigator)
20197483 Mutation in transforming growth factor beta receptor II is associated with colorectal cancer.
20165854 The expression of TGF-beta1, its receptor TGFbetaRII, and signaling proteins Smad4 and Smad7 was observed in the majority of colorectal cancer specimens.
20157331 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20144264 Mutations of the TGFBR2 gene in Chinese patients with Marfan-related syndrome are reported.
20139972 TGFBR2 forms an endocytic complex with PTH1R in response to PTH and regulates signalling by PTH and TGF-beta. TGFBR2 directly phosphorylates the PTH1R cytoplasmic domain, which modulates PTH-induced endocytosis of the PTH1R-TGFBR2 complex.
20101701 a missense mutation of TGFBR2 may have a role in aortic root and pulmonary artery aneurysms in a neonate with Loeys-Dietz syndrome type 1B [case report]
20101206 Extracellular matrix-induced transforming growth factor-beta receptor signaling dynamics.
20079749 Elf3 amino acid residues within the flanking region, including Trp361, are important for the structural integrity of the protein as well as for the Efl3 DNA binding and transactivation activity.
20073064 Low TbetaR-II protein level is due to augmented ubiquitin-dependent degradation and may be involved in lowering of TGF-beta signaling pathway in renal cell carcinoma.
20067791 Data show that exon junction complex (EJC) downstream of a PTC plays an inhibitory role in translation of TGFbetaR2 mRNA.
19996017 Clinical outcomes appear similar between treated patients with TGFBR2 mutations and individuals with FBN1 mutations in Marfan syndrome and related disorders.
19959123 The researchers found an association between a common TGFRB2 polymorphism and the risk of sudden cardiac arrest coupled with ventricular arrhythmias in the presence of coronary artery disease.
19959123 Observational study of gene-disease association. (HuGE Navigator)
19937272 Our data provide evidence that TGF-beta signaling patterns vary by age and pathologic features of prognostic significance including ER expression
19916025 Mutations and/or alterations in expression of TGF-beta receptors and loss of Smad 4 are frequent in human ovarian cancers.
19914962 TGF-betaRII protein analysis in tumour cells could be introduced in clinical practice as additional prognostic biomarker in HER2-negative breast cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19886734 We show differences in expression of glycosaminoglycans are related to the over-expression of TGF-beta and TGF-betaRII in cultured fibroblasts from hereditary gingival fibromatosis and gingival fibroblasts treated with CyA.
19883511 two novel mutations in the TGFBR1 and TGFBR2 genes in two patients affected with Loeys-Dietz syndrome (LDS) and showing marked phenotypic variability.
19737884 These data show that trichostatin a induces the expression of TbetaR-II mRNA and activates the TbetaR-II promoter in retinoblastoma cells.
19672284 Genetic variations in TGFBR2 associate with abdominal aortic aneurysm in a Dutch population.
19672284 Observational study of gene-disease association. (HuGE Navigator)
19639654 Observational study of gene-disease association. (HuGE Navigator)
19626999 Compared with human fallopian tubes without adhesions or atresias, the expression of TGFbeta1, TGFBR1 and TGFBR2 all increased significantly in adhesion cases.
19624886 TGF-betaRII expression was related with depth of invasion, lymph node metastasis, tumor differentiation, and Lauren classification of gastric cancer.
19601999 polymorphism in TGFBR2 are associated with altered secretion of OPN, supporting a role for transforming growth factor beta in OPN production.
19601999 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19548309 TGFbetaR2 hypermethylation is associated with multiple myeloma.
19542084 Individuals with TGFBR2 mutations are more likely to dissect at aortic diameters <5.0 cm than individuals with TGFBR1 mutations.
19542084 Observational study of gene-disease association. (HuGE Navigator)
19538865 Low expression of Smad4 and TbetaRII may promote metastasis of oral squamous cell carcinoma.
19533785 Out of 41 probands with Marfan syndrome, six were identified to have novel TGFBR2 mutations (one frameshift and five missense mutations).
19533785 Observational study of gene-disease association. (HuGE Navigator)
19503063 The four most frequently mutated genes in colorectal cancers with microsatellite instability were ACVR2 (92%), TAF1B (84%), ASTE1/HT001 (80%) and TGFBR2 (77%).
19453261 Observational study of gene-disease association. (HuGE Navigator)
19434696 Observational study of gene-disease association. (HuGE Navigator)
19426152 loss of TGFbetaRII in hepatocellular carcinoma triggers activation of the TNF pathway known to be regulated by TGF-beta(1) network
19424605 1167Cright curved arrow T (Asn389Asn) polymorphism of TGFBR2 were most significantly associated with chronic kidney disease in low-risk individuals.
19366699 Critical role of type II receptors in balancing BMP9 signaling via ALK1 and emphasize the essential role for BMPR-II in a subset of BMP9 responses in pulmonary artery endothelial cells.
19356148 These results indicate that the extracellular domain of TbetaRII mediates receptor partitioning into membrane rafts and efficient entrance into caveolin-positive endosomes.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19335617 Data show that co-expressing constitutively active type I and type II receptors resulted in the phosphorylation of both R-Smad subclasses in a ligand-independent manner.
19299629 Observational study of gene-disease association. (HuGE Navigator)
19293232 The TGFBR2 presence reduced binding of probes specific for a core substitution and increased branch length in N-glycosylation, even reaching a P-value of 0.0016.
19229971 Observational study of gene-disease association. (HuGE Navigator)
19193655 hENT1 is down-regulated by activation of TbetaRII by TGF-beta1 in endothelium from umbilical veins.
19161338 High-affinity binding of TGF-beta1/3 to TGF-betaRII is primarily due to hydrogen bonding between Arg25 and 94 of TGF-beta1/3, and Glu119 and Asp32 of TbetaR-II. Arg25 and 94 are substituted by Lys in TGF-beta2, which binds with low affinity to TbetaR-II.
19147499 TGF-beta1 elevates TbetaRII homodimerization to some degree and strongly enhances TbetaRI.TbetaRII heteromeric complex formation.
19088080 the TGFbeta pathway activation leads to recruitment of a KLF14-mSin3A-HDAC2 repressor complex to the TGFbetaRII promoter, as well as the remodeling of chromatin to increase histone marks that associate with transcriptional silencing.
19020727 sTbetaRII attenuates the biological activities of TGF-beta in colorectal cancer
19006214 report of somatic mosaicism of a TGFBR2 missense mutation, c.1336G>A (D446N)in a patient with Loeys-Dietz syndrome; DNA from leukocytes, buccal cells, hair root cells, & nails in the father indicated 52%, 25%, 0%, & 35% of cells harbored the mutation
18941508 The -1 bp frameshift mutation rates of TGFBR2 and ACVR2 microsatellite sequences are dependent upon the human DNA Mismatch repair background
18829577 DHT decreases the level of TGF-beta receptor II (TbetaRII) through a transcriptional mechanism.
18781618 Mutations and polymorphisms in TGFBR1 and TGFBR2 in patients with Marfan syndrome, Loeys-Dietz syndrome and related disorders are described.
18781618 Observational study of gene-disease association. (HuGE Navigator)
18724388 the frequent loss of stromal TGF-beta type II receptor expression in prostate cancer can relieve the paracrine suppression of Wnt3a expression
18721526 Mutations in TGFBR1 and TGFBR2 rarely cause sporadic BAV.
18721526 Observational study of gene-disease association. (HuGE Navigator)
18683732 The expression level of TGF-betaR II in CD8+ T cells of oral lichen planus did not increase compared with the controls.
18648910 the expression levels of TbetaRII and Smad2 in Sertoli Cell-Only Syndrome testes were upregulated compared to that in the normal controls.
18598696 The roles played by the ecto/transmembrane (ecto/TM) domains and endodomains of RI and RII TGF-beta receptors in these processes by transfecting 293 or HeLa cells with different combinations of receptor mutants, was analysed.
18550062 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18546940 The high expression of genes coding TGFbetaRI, TGF-betaRII and TGF-betaRIII receptors in all the polyps and healthy tissues, show readiness to transduction of TGFbeta
18514338 A significant elevation in expression of TGFBR2 in oral squamous cell carcinoma cells was seen in carbon and neon-irradiated cells.
18453574 mature human M2 macrophages made permissive to TGF-beta by glucocorticoid-induced surface expression of TGF-betaRII activate in response to TGF-beta1
18398939 Mesenchymal stem cells from patients with osteoarthritis showed significantly increased total TGF-beta, TGF-beta1 isoform, TBR-II, and TBR-III mRNA expression compared to controls.
18382895 The exogenous tTGFbetaRII can efficiently trap TGF-beta I from access to wild-type receptors and can suppress TGF-beta I triggered signals. Thus it may potentially be clinically applied to scar therapy.
18339844 Cancer-associated missense mutations of the T beta RII gene (TGFBR2) are associated with at least two different phenotypes.
18334936 Filtering bleb scarring is associated with an abundant expression of TGF-beta receptors in activated fibroblasts and the deposition of the fibrogenic ED-A fibronectin splice-variant.
18264665 TGFBR2 mutations are not a major factor in spontaneous spinal CSF leaks.
18243111 TGF-beta complexes assemble cooperatively through recruitment of the low-affinity (type I) receptor by the ligand-bound high-affinity (type II) pair.
18202754 TGF-beta1, TbetaRI, and TbetaRII loss of expression correlates with differentiation in human oral squamous cell carcinomas
18199825 KSHV evades both the antiproliferative effects of TGF-beta signaling by silencing TbetaRII gene expression and immune recognition by suppressing TGF-beta-responsive immune cells through the elevated secretion of TGF-beta1
18174230 Observational study of gene-disease association. (HuGE Navigator)
18097622 The aim of this study was to analyse the profile of TGF-beta1 and the expression of its receptor (TbetaR I, TbetaR II and TbetaR III-betaglycan) genes in IPAH and in secondary forms of pulmonary arterial hypertension [Eisenmenger's syndrome patients].
18095113 sequencing of exon 4 of the transforming growth factor-beta receptor type II gene, which showed a band shift by single-strand conformation polymorphism, disclosed a single nucleotide polymorphism
18084123 Molecular genetic analysis demonstrated a heterozygous missense mutation of the transforming growth factor-beta receptor II gene in both the patient and his father, which thus caused Loeys-Dietz syndrome.
18053089 IL-1beta decreases TbetaRII expression by inducing Sp3 via NFkappaB
18043895 TGFbeta2 and TbetaRII have roles in the antiestrogenic activity of tamoxifen metabolites in breast cancer
17985359 Both genomic instability and clonal selection of transforming growth factor beta resistant cells contribute to the high frequency of TGFBR2 mutations in microsatellite unstable colon cancer.
17950544 Mutations at the mononucleotide repeats within the TGF-betaRII gene occurred in certain basal cell carcinomas, not always in association with microsatellite instability .
17875924 Mutant p53 attenuates TGF-beta1 signaling. This was exhibited by a reduction in SMAD2/3 phosphorylation and an inhibition of both the formation of SMAD2/SMAD4 complexes and the translocation of SMAD4 to the cell nucleus.
17845732 The identification of the splice variants T beta RIB and the novel isoform T beta RIIC in man clearly contributes to the growing complexity of the TGF-beta family.
17692120 TGF-beta receptor 2 downregulation in tumor-associated stroma is associated with colon carcinoma
17680270 genetic variants in transforming growth factor beta receptor II may modulate the risk of esophageal squamous cell carcinoma
17680270 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17676583 it was observed the progression of premalignant lung lesions toward carcinoma in situ is accompanied by a decrease in TBR II expression and apoptosis and an increase in the expression of Ki-67 and MC
17676485 Alterations in TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 genes of microsatellite instability are rare in urinary bladder carcinoma and they are not associated with microsatellite instability or the presence of p53 mutations.
17653092 RANTES signaling is required for invasion in TGFbetaRII-deficient neoplastic cells.
17652900 mutations in the TGFBR1,2 gene may be associated with greater phenotypic heterogeneity than previously reported
17637743 TGF-beta signaling in reactive stroma is angiogenic and tumor promoting and is mediated in part through a TbetaRII/Smad3-dependent upregulation of FGF-2 expression and release.
17634290 Sequential cytoplasmic truncations resulted in receptor missorting to apical surfaces, and they indicated an essential targeting element(s) near the receptor's C terminus.
17566598 the defective TGFBR2 expression might contribute to the carcinogenesis and/or development of large cell carcinoma
17562261 Genetic variants of TGFB1 and TGFBR2 genes may contribute to the risk of developing gastric cancer.
17562261 Observational study of gene-disease association. (HuGE Navigator)
17560608 TGFBR2 gene is reported to be linked to schizophrenia.
17560608 Observational study of gene-disease association. (HuGE Navigator)
17470566 This review of 5 cases describes patients with musculoskeletal abnormalities and a TGFBR2 mutation in the neonatal period who are subsequently diagnosed with Loeys-Dietz syndrome.
17427197 High D-glucose increases L-arginine transport and eNOS expression following TbetaRII activation by TGF-beta1 involving p42/44(mapk) and Smad2 in HUVEC.
17418587 Observational study of gene-disease association. (HuGE Navigator)
17365852 TGF-beta receptor type II and its mRNA were found in platelets.
17339425 data suggest that promoter methylation plays an important role in T beta RII gene silencing and subsequent development of a TGF-beta1-resistant phenotype by some B-cell lymphoma cells
17330129 Genetic testing revealed in patient with diffuse and rapidly progressing vascular disease a de novo mutation in transforming growth factor receptor 2.
17319955 Observational study of gene-disease association. (HuGE Navigator)
17319955 common variants in TGFBR2 gene do not strongly influence genetic susceptibility to diabetic nephropathy in an Irish Caucasian population.
17270239 Observational study of gene-disease association. (HuGE Navigator)
17270239 TGFBR2 mutation is associated with CpG island methylator phenotype-high colorectal cancer and indirectly with RUNX3 methylation
17194537 These results also indicate that the CSF level assay of TGF-beta1, TbetaR-II and LRG is useful for the diagnosis of patients with INPH, and TGF-beta1, TbetaR-II and LRG may be involved in the pathogenesis of the disease.
17187359 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17187359 The variant alleles of the promoter polymorphisms, TGFB1 C-509T and TGFBR2 G-875A, were associated with a significantly decreased risk of gastric cancer.
17146441 mutations of the amino-acid residues, D55 and E142 of TbetaR-II, resulted in loss of TGF-beta binding and downstream signaling activity
17117417 Mutated TGFBR2 seems to play an important role in the abrogation of transforming growth factor beta signal transduction in giant cell carcinoma cells.
17112860 TGF-beta RII was not upregulated in cyclosporine-induced gingival growth in patients after kidney transplantation.
17107667 epidermal growth factor (EGF)-mediated induction of TbetaRII expression may participate in a synergistic interplay between EGF and TGF-beta signaling pathway
17087113 The expression of TGFbetaR I and TGFbetaR II protein in nasal polyps tissues was significant increased than that in chronic rhinosinusitis tissues.
17086361 The human TbetaRII overexpressed in highly malignant K-ras-transformed thyroid cell clones is a functional receptor essential for a strong reduction of adhesive & migratory behaviour of these cells.
16928994 Mutations in either TGFBR1 or TGFBR2 predispose patients to aggressive and widespread vascular disease (Loeys-Dietz syndrome)
16885183 Results from this family provides further evidence that mutations in TGFbetaR2 cause a distinct syndrome.
16849474 Mice transgenic for directed expression of a dominant negative TGF beta receptor type II, under the CD4 promoter lacking the CD8 silencer, spontaneously develop features characteristic of primary biliary cirrhosis.
16835936 A comprehensive genetic analysis of TGFBR2 was performed in patients with Marfan syndrome or Marfan-related phenotypes.
16824508 Signaling through Tgfbr2 regulates the maintenance of boundaries in the sclerotome and developing axial skeleton in transgenic mice.
16733295 levels of TGFbeta-1 and TGFbeta R-2 were increased in the intimal matrices, smooth muscle cells, and macrophages, as well as in endothelial cells of atherosclerotic aorta
16673206 reduced transforming growth factor-beta type II receptor expression may play a critical role in determining the malignant phenotype of human adrenocortical carcinoma
16573164 The mutation rate of Poly A site of transforming growth factor-beta1 receptor type II in multiple sites keloid was significant higher than that in single site keloid.
16549496 Down-regulation of TbetaRII in dermal cells or up-regulation of TbetaRII in epidermal cells reverses their migratory responses to serum and plasma, respectively.
16528739 Results of this analysis appear to exclude a role for the TGFBR1- or TGFBR2-mediated pathway effect in Kabuki syndrome.
16428382 changes in TbetaRII levels by EGF are EGF receptor-kinase-dependent and are controlled by signals downstream of MEK1/2
16388503 prostate cancer cells mediate growth inhibition and differentiation of bone marrow endothelial cells through alteration of TGFbetaRII-mediated signal transduction.
16380996 Observational study of gene-disease association. (HuGE Navigator)
16283890 Identification of a novel TGFBR2 gene mutation in a Korean patient with Loeys-Dietz aortic aneurysm syndrome; no mutation in TGFBR2 gene in 30 patients with classic Marfan's syndrome.
16108056 TGFBR2 mutations is associated with deregulation of cdk4 and colon cancer
15976377 Repression of type II TGF-beta receptor may act as significant determinant of lung adenocarcinoma invasiveness, an early step in tumor progression toward metastasis.
15942678 blockade of TGF-beta after intramuscular transfer of the soluble type II TGF-beta receptor gene suppressed hepatic fibrosis
15861007 Identification of TGFBR2 mutations in Marfan syndrome type II provided the direct evidence of the relation in humans.
15824172 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15811425 UV-induced down-regulation of TbetaRII and the concerted over-expression of Smad7 may trigger the inhibition of the TGF-beta-induced phosphorylation of Smad2.
15731757 possible role of heterozygous mutation in a newly described human phenotype that includes widespread perturbations in cardiovascular, craniofacial, neurocognitive and skeletal development
15647279 transforming growth factor beta type II receptor promoter activity and acetylation of Sp1 by recruitment of PCAF/p300 to a Sp1.NF-Y complex are induced by Trichostatin A
15522964 thrombin via PAR1 induced the internalization of endoglin and type-II TGF-beta receptor (TbetaRII) but not type-I receptors in human ECs
15350299 The first characterized nonepithelial tumors in hereditary nonpolyposis colorectal cancer seem to carry a limited panel of dna replication errors, including a frameshift at the TGFBR2 gene.
15305380 Observational study of gene-disease association. (HuGE Navigator)
15235604 Our studies show that RDH12 is associated with retinal dystrophy and encodes an enzyme with a unique, nonredundant role in the photoreceptor cells.
15146427 an increased TGFbetaRI:TGFbetaRII ratio may underlie aberrant TGFbeta signaling in systemic sclerosis and contribute to elevated basal collagen production
15102771 combined production of the immunosuppressants IL-10 and TGF-beta, as well as coexpression of TGF-beta RI and RII (required for cellular response to TGF-beta), may act to down-modulate host anti-Mycobacterium tuberculosis immunity
15017149 NMR analysis of the extracellular domain of the human TGFbeta type II receptor in complex with monomeric TGFbeta3
15009106 Observational study of gene-disease association. (HuGE Navigator)
14976186 each of the five Ets proteins influences the TbetaR-II promoter in a unique manner because of important differences in their biochemical properties or their patterns of cellular expression
14760070 TGFBR2 has a role in progression of estrogen receptor-negative breast cancer
14727154 Observational study of gene-disease association. (HuGE Navigator)
14704634 expression values for TGF 1 and its receptors I, II, and III were twice as high in the group of patients with a diagnosis of high-grade lymphomas as in the group of patients diagnosed with low-grade lymphomas
14601051 TbetaRII in transgenic mice plays a critical role in maintaining the nondifferentiated character of virgin mammary gland epithelium.
14582709 ERT mediates the expression of TGF-beta RII, and the transcriptional inhibition of ets-related transcription factor could be a one of the mechanisms of colonic carcinogenesis
12970754 We observed subsequent loss of type II TGFbeta receptor (TBR2) expression in metastatic renal cell carcinomas [RCC}. We propose that loss of TBR3 is necessary for RCC carcinogenesis, and loss of TBR2 leads to acquisition of a metastatic phenotype.
12915548 Transforming growth factor beta1 receptor II is downregulated by E1A in adenovirus-infected cells.
12873459 Observational study of gene-disease association. (HuGE Navigator)
12840808 role of a CCAAT box and three GC boxes in the regulation of the TbetaR-II promoters in embryonal carcinoma-differentiated cells
12825850 Human breast tumors were screened for TGFBR2 mutation and/or altered expression of TGFBR2 protein. TGFBR2 was expressed in the epithelium and stroma of tumors, and was higher in patients having positive lymph nodes and/or negative ER and PR expression.
12736050 The loss of TbetaR-II expression in the primary tumor is associated with clinical stage (P <0.01) and predicts a significantly lower survival rate in renal cell carcinoma patients.
12607775 TGF-beta2 receptor expression in peritoneal fibroblasts was increased by hypoxia or hypoxia plus TGF-beta1, but decreased by TGF-beta1 alone.
12515396 This protein was expressed locally in the media and adeventitia at injected arterial segments without any significant dissemination to remote areas.
12479849 Coding region microsatellite mutations characteristic of defective mismatch repair Identification of TGFbetaRII coding region microsatellite mutations in vivo implicates this gene in the pathogenesis of human T-LBL/ALL.
12215842 Differential rates of frameshift alterations in four repeat sequences of hereditary nonpolyposis colorectal cancer tumors.These repeats consisted of (A)10 in the TGF beta RII, (G)8 in the BAX, (A)8 in the CASP1, and (CCA)7 in the APP genes.
12202987 Observational study of genotype prevalence. (HuGE Navigator)
12174910 data suggest the existence of a further definite subgroup of diffuse-type gastric carcinomas with altered TGFbeta-IIR expression, independent from a mutator phenotype with TGFbeta-IIR gene mutations
12077447 TGFBII receptors were purified and refolded; they have an apparent molecular weight of 14 kDa as by size-exclusion chromatography
12060054 present in diabetic foot ulcer
11850637 crystal structure of the human TbetaR2 ectodomain--TGF-beta3 complex
11820800 TGF beta type II receptor mRNA concentration on the surface of human osteoblasts is increased by 1 alpha,25-dihydroxyvitamin D3 due to changes in receptor mRNA stability not associated with an increase in the rate of gene transcription.
11777969 Overexpression of a dominant negatively acting mutant of TGFBR2 in primitive hemopoietic progenitor cells renders them transiently unresponsive to both autocrine and paracrine TGF-beta signaling and leads to their enhanced survival and proliferation.
11744689 treatment with the HDAC inhibitor induces TbetaRII promoter activity by the recruitment of the PCAF protein to the NF-Y complex, interacting with the inverted CCAAT box in the TbetaRII promoter
11741970 Altogether, these results identify a mechanism by which RhoB antagonizes TGF-beta action through transcriptional down-regulation of AP1 in T beta R-II promoter.
11251969 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11158177 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSN      1 - 70
CSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS     71 - 140
DECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLM    141 - 210
EFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP    211 - 280
YEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKL    281 - 350
GSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG    351 - 420
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDN    421 - 490
VLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPED    491 - 560
GSLNTTK                                                                   561 - 567
//

Text Mined References (417)

PMID Year Title
27048361 2016 Inhibition of BMP and of TGF? receptors downregulates expression of XIAP and TAK1 leading to lung cancer cell death.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26867007 2016 Angiotensin II Type 2 Receptor Decreases Transforming Growth Factor-? Type II Receptor Expression and Function in Human Renal Proximal Tubule Cells.
26823785 2015 Expression of CDKN1A/p21 and TGFBR2 in breast cancer and their prognostic significance.
26780887 2016 Reduction of fibroblast size/mechanical force down-regulates TGF-? type II receptor: implications for human skin aging.
26652004 2015 Discrete spatial organization of TGF? receptors couples receptor multimerization and signaling to cellular tension.
26551005 2015 Clinical Implications of T?RII Expression in Breast Cancer.
26542979 2016 miR-1343 attenuates pathways of fibrosis by targeting the TGF-? receptors.
26511382 2015 TGF-?2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26505114 2016 Intraislet Pancreatic Ducts Can Give Rise to Insulin-Positive Cells.
26498065 2016 miRNA expression profile of vulvar squamous cell carcinoma and identification of the oncogenic role of miR-590-5p.
26459119 2015 MicroRNA-590 is an EMT-suppressive microRNA involved in the TGF? signaling pathway.
26356817 2015 An epigenetic auto-feedback loop regulates TGF-? type II receptor expression and function in NSCLC.
26301661 2015 A novel mutation of TGFBR2 causing Loeys-Dietz syndrome complicated with pregnancy-related fatal cervical arterial dissections.
26252213 2015 Increased Expression of TGF?R2 Is Associated with the Clinical Outcome of Non-Small Cell Lung Cancer Patients Treated with Chemotherapy.
26169464 2015 Vertebral Artery Aneurysm Mimicking as Left Subclavian Artery Aneurysm in a Patient with Transforming Growth Factor Beta Receptor II Mutation.
26168957 2015 Transforming growth factor ? type II receptor as a marker in diffuse large B cell lymphoma.
26115412 2015 Matrix rigidity regulates the transition of tumor cells to a bone-destructive phenotype through integrin ?3 and TGF-? receptor type II.
26114631 2015 Reconstitution of TGFBR2-Mediated Signaling Causes Upregulation of GDF-15 in HCT116 Colorectal Cancer Cells.
26078295 2015 Patient Mutation Directed shRNA Screen Uncovers Novel Bladder Tumor Growth Suppressors.
26073093 2015 The non-detergent sulfobetaine-201 acts as a pharmacological chaperone to promote folding and crystallization of the type II TGF-? receptor extracellular domain.
26037400 2015 Vitamin D levels in multiple sclerosis patients: Association with TGF-?2, TGF-?RI, and TGF-?RII expression.
26022443 2015 Association of TGFBR2 rs6785358 Polymorphism with Increased Risk of Congenital Ventricular Septal Defect in a Chinese Population.
26017485 2015 First genetic analysis of aneurysm genes in familial and sporadic abdominal aortic aneurysm.
25928368 2015 TGF?-1 and TGFBR2 polymorphisms, cooking oil fume exposure and risk of lung adenocarcinoma in Chinese nonsmoking females: a case control study.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25882708 2015 Latent transforming growth factor binding protein 4 regulates transforming growth factor beta receptor stability.
25849327 2015 Assessment of variation in immunosuppressive pathway genes reveals TGFBR2 to be associated with prognosis of estrogen receptor-negative breast cancer after chemotherapy.
25833830 2015 Loss of TGF? Receptor Type 2 Expression Impairs Estrogen Response and Confers Tamoxifen Resistance.
25826292 2015 Influence of age and physical fitness on miRNA-21, TGF-? and its receptors in leukocytes of healthy women.
25736321 2015 Transforming Growth Factor ? Signaling in Colorectal Cancer Cells With Microsatellite Instability Despite Biallelic Mutations in TGFBR2.
25631750 2015 Simvastatin downregulates expression of TGF-?RII and inhibits proliferation of A549 cells via ERK.
25617554 2014 Association between TGFBR2 gene polymorphisms and congenital heart defects in Han Chinese population.
25551793 2014 MicroRNA-301a promotes migration and invasion by targeting TGFBR2 in human colorectal cancer.
25542272 2015 Increased pSmad2 expression and cytoplasmic predominant presence of TGF-?RII in breast cancer tissue are associated with poor prognosis: results from the Shanghai Breast Cancer Study.
25501507 2015 MicroRNA-34a inhibits the proliferation and promotes the apoptosis of non-small cell lung cancer H1299 cell line by targeting TGF?R2.
25472963 2015 Krüppel-like factor KLF10 regulates transforming growth factor receptor II expression and TGF-? signaling in CD8+ T lymphocytes.
25443138 2015 MicroRNA-19a enhances proliferation of bronchial epithelial cells by targeting TGF?R2 gene in severe asthma.
25374194 2014 Association between the TGFBR2 G-875A polymorphism and cancer risk: evidence from a meta-analysis.
25323858 2015 MicroRNA miR145 regulates TGFBR2 expression and matrix synthesis in vascular smooth muscle cells.
25315765 2014 Metastatic tumor evolution and organoid modeling implicate TGFBR2 as a cancer driver in diffuse gastric cancer.
25234828 2014 Ultraviolet irradiation represses TGF-? type II receptor transcription through a 38-bp sequence in the proximal promoter in human skin fibroblasts.
25233932 2014 Concerted loss of TGF?-mediated proliferation control and E-cadherin disrupts epithelial homeostasis and causes oral squamous cell carcinoma.
25222187 2014 One patient, two lesions, two oncogenic drivers of gastric cancer.
25169976 2014 PDGF receptor-? promotes TGF-? signaling in hepatic stellate cells via transcriptional and posttranscriptional regulation of TGF-? receptors.
25117820 2014 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100.
24973511 2014 Mutual regulation of TGF-?1, T?RII and ErbB receptors expression in human thyroid carcinomas.
24846200 2014 The early manifestation, tumor-specific occurrence and prognostic significance of TGFBR2 aberrant splicing in oral carcinoma.
24793577 2014 The spectrum of FBN1, TGF?R1, TGF?R2 and ACTA2 variants in 594 individuals with suspected Marfan Syndrome, Loeys-Dietz Syndrome or Thoracic Aortic Aneurysms and Dissections (TAAD).
24687999 2014 Common variants in TGFBR2 and miR-518 genes are associated with hypertension in the Chinese population.
24606633 2014 TGF?R2 is a major target of miR-93 in nasopharyngeal carcinoma aggressiveness.
24597762 2014 GDF15 regulates Kv2.1-mediated outward K+ current through the Akt/mTOR signalling pathway in rat cerebellar granule cells.
24550076 2014 Oxidative exposure impairs TGF-? pathway via reduction of type II receptor and SMAD3 in human skin fibroblasts.
24443223 2014 Polymorphisms of VEGF, TGF?1, TGF?R2 and conotruncal heart defects in a Chinese population.
24344637 2014 Dural ectasia in Loeys-Dietz syndrome: comprehensive study of 30 patients with a TGFBR1 or TGFBR2 mutation.
24336330 2015 TGF-beta receptor type-2 expression in cancer-associated fibroblasts regulates breast cancer cell growth and survival and is a prognostic marker in pre-menopausal breast cancer.
24284203 2014 CCAAT/enhancer binding protein-mediated regulation of TGF? receptor 2 expression determines the hepatoblast fate decision.
24279395 2014 Expression of transforming growth factor ? and fibroblast growth factor 2 in the lens epithelium of Morioka cataract mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24263861 2013 HCV NS3 protease enhances liver fibrosis via binding to and activating TGF-? type I receptor.
24243761 2014 Screening of TGFBR1, TGFBR2, and FLNA in familial mitral valve prolapse.
24151081 2014 MicroRNA-200b stimulates tumour growth in TGFBR2-null colorectal cancers by negatively regulating p27/kip1.
24141771 2014 A reciprocal role of prostate cancer on stromal DNA damage.
24093773 2013 Serum levels of matrix metalloproteinases 2 and 9 and TGFBR2 gene screening in patients with ascending aortic dilatation.
24037531 2014 Androgen receptor and microRNA-21 axis downregulates transforming growth factor beta receptor II (TGFBR2) expression in prostate cancer.
24034922 2013 [Association of single nucleotide polymorphism in TGFBR2 gene with Kawasaki disease and coronary artery lesions].
23970096 2013 Mutation of TGF-? receptor II facilitates human bladder cancer progression through altered TGF-?1 signaling pathway.
23951322 2013 Improvement of a predictive model of castration-resistant prostate cancer: functional genetic variants in TGF?1 signaling pathway modulation.
23913824 2013 Novel mutations and expression alterations in SMAD3/TGFBR2 genes in oral carcinoma correlate with poor prognosis.
23899993 2013 The elevated number of circulating regulatory T cells in patients with transient hypogammaglobulinemia of infancy is not associated with any abnormalities in the genes encoding the TGF-? receptors.
23883197 2013 Association between a TGFBR2 gene polymorphism (rs2228048, Asn389Asn) and acute rejection in Korean kidney transplantation recipients.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23750746 2013 Biliary epithelial senescence and plasticity in acute cellular rejection.
23734265 2013 TLR4 ligand/H?O? enhances TGF-?1 signaling to induce metastatic potential of non-invasive breast cancer cells by activating non-Smad pathways.
23726841 2013 miR-211 promotes the progression of head and neck carcinomas by targeting TGF?RII.
23690952 2013 miR-655 Is an EMT-suppressive microRNA targeting ZEB1 and TGFBR2.
23548068 2013 Variation in endoglin pathway genes is associated with preeclampsia: a case-control candidate gene association study.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23454766 2013 IQGAP1 suppresses T?RII-mediated myofibroblastic activation and metastatic growth in liver.
23395552 2013 Overexpression of microRNA-21 is associated with elevated pro-inflammatory cytokines in dominant-negative TGF-? receptor type II mouse.
23312833 2013 Treatment of a patient with vertebral and subclavian aneurysms in the setting of a TGFBR2 mutation.
23290524 2013 c-Cbl-mediated neddylation antagonizes ubiquitination and degradation of the TGF-? type II receptor.
23248962 2012 [Gene expression of transforming growth factor beta receptor II in the epidermis of pathological scar].
23228659 2013 TGFBR2 gene polymorphism is associated with ossification of the posterior longitudinal ligament.
23220853 2012 Absence of TGF-?RII predicts bone and lung metastasis and is associated with poor prognosis in stage III breast tumors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178117 2012 MED12 controls the response to multiple cancer drugs through regulation of TGF-? receptor signaling.
23157888 2012 [An association study between transforming growth factor-?1 receptor 2 gene polymorphisms and essential hypertension].
23099432 2012 TGF?RIIb mutations trigger aortic aneurysm pathogenesis by altering transforming growth factor ?2 signal transduction.
22972928 2012 Dendritic cell-specific disruption of TGF-? receptor II leads to altered regulatory T cell phenotype and spontaneous multiorgan autoimmunity.
22912877 2012 Colorectal cancer migration and invasion initiated by microRNA-106a.
22848678 2012 HILI inhibits TGF-? signaling by interacting with Hsp90 and promoting T?R degradation.
22739178 2012 [Expression of transforming growth factor-?1 and its receptors in peripheral blood of patients with immune thrombocytopenic purpura].
22734312 Arterial tortuosity and aneurysm in a case of Loeys-Dietz syndrome type IB with a mutation p.R537P in the TGFBR2 gene.
22684895 2012 MicroRNA-590-5p regulates proliferation and invasion in human hepatocellular carcinoma cells by targeting TGF-? RII.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22672900 2012 Transforming growth factor-? suppresses metastasis in a subset of human colon carcinoma cells.
22651914 2012 Structural studies of the TGF-?s and their receptors - insights into evolution of the TGF-? superfamily.
22617150 2012 Post-translational regulation of TGF-? receptor and Smad signaling.
22585622 2012 Notch activation on effector T cells increases their sensitivity to Treg cell-mediated suppression through upregulation of TGF-?RII expression.
22571197 2012 TGF-? sensitivity is determined by N-linked glycosylation of the type II TGF-? receptor.
22539603 2012 Pathway analyses identify TGFBR2 as potential breast cancer susceptibility gene: results from a consortium study among Asians.
22431140 2012 TGFBR2 but not SPP1 genotype modulates osteopontin expression in Duchenne muscular dystrophy muscle.
22425785 2012 Regulatory mechanism of transforming growth factor beta receptor type II degradation by interleukin-1 in primary chondrocytes.
22399565 2012 Loss of transforming growth factor beta type II receptor increases aggressive tumor behavior and reduces survival in lung adenocarcinoma and squamous cell carcinoma.
22391627 2012 Evaluation of the prognostic value of TGF-? superfamily type I receptor and TGF-? type II receptor expression in nasopharyngeal carcinoma using high-throughput tissue microarrays.
22314103 2012 Concordant promoter methylation of transforming growth factor-beta receptor types I and II occurs early in esophageal squamous cell carcinoma.
22310065 2012 Downregulation of transforming growth factor, beta receptor 2 and Notch signaling pathway in human abdominal aortic aneurysm.
22290546 2012 Polymorphisms in the potential functional regions of the TGF-? 1 and TGF-? receptor genes and disease susceptibility in HBV-related hepatocellular carcinoma patients.
22278155 2012 Prognostic significance of transforming growth factor beta (TGF-?) signaling axis molecules and E-cadherin in colorectal cancer.
22259224 2012 Genotype-phenotype analysis of F-helix mutations at the kinase domain of TGFBR2, including a type 2 Marfan syndrome familial study.
22113417 2012 Clinical features and genetic analysis of Korean patients with Loeys-Dietz syndrome.
22095581 2012 Low bone mass and high material bone density in two patients with Loeys-Dietz syndrome caused by transforming growth factor beta receptor 2 mutations.
22093616 2012 A novel gain-of-function mutation of TGF-? receptor II promotes cancer progression via delayed receptor internalization in oral squamous cell carcinoma.
22072622 2012 MicroRNA-21 induces stemness by downregulating transforming growth factor beta receptor 2 (TGF?R2) in colon cancer cells.
22028617 2011 Elucidating the mechanism of regulation of transforming growth factor ? Type II receptor expression in human lung cancer cell lines.
21978186 2012 The transforming growth factor-? receptor genes and the risk of intracranial aneurysms.
21949851 2011 TGFBR2 and BAX mononucleotide tract mutations, microsatellite instability, and prognosis in 1072 colorectal cancers.
21949523 2011 A sporadic case of Loeys-Dietz syndrome type I with two novel mutations of the TGFBR2 gene.
21924348 2012 Regulation of TGF? receptor trafficking and signaling by atypical protein kinase C.
21855067 2011 Meta-analysis of the association between single nucleotide polymorphisms in TGF-? receptor genes and abdominal aortic aneurysm.
21815248 2011 Autosomal dominant inheritance of a predisposition to thoracic aortic aneurysms and dissections and intracranial saccular aneurysms.
21789464 2011 Candidate gene linkage analysis indicates genetic heterogeneity in Marfan syndrome.
21785915 2012 Association of polymorphisms in transforming growth factor-? receptors with susceptibility to gastric cardia adenocarcinoma.
21757750 2011 Histone deacetylase inhibitor belinostat represses survivin expression through reactivation of transforming growth factor beta (TGFbeta) receptor II leading to cancer cell death.
21737283 2011 Susceptible gene single nucleotide polymorphism and hemorrhage risk in patients with brain arteriovenous malformation.
21725601 Effects of TGF-? signaling blockade on human A549 lung adenocarcinoma cell lines.
21701930 2012 Molecular profiling of direct xenograft tumors established from human pancreatic adenocarcinoma after neoadjuvant therapy.
21666718 2012 Overexpression of miR-370 and downregulation of its novel target TGF?-RII contribute to the progression of gastric carcinoma.
21609163 2011 Association between TGFBR2 gene polymorphism (rs2228048, Asn389Asn) and intracerebral hemorrhage in Korean population.
21454688 2011 Restoration of transforming growth factor-beta receptor II expression in colon cancer cells with microsatellite instability increases metastatic potential in vivo.
21441952 2011 SCUBE3 is an endogenous TGF-? receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.
21423151 2011 TGF-? signalling is mediated by two autonomously functioning T?RI:T?RII pairs.
21358634 2011 Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1.
21352603 2011 Downregulation of TGF-beta receptor types II and III in oral squamous cell carcinoma and oral carcinoma-associated fibroblasts.
21324918 2011 Familial aortic aneurysm and dissection due to transforming growth factor-beta receptor 2 mutation.
21295082 2011 The TGF-? co-receptor, CD109, promotes internalization and degradation of TGF-? receptors.
21270064 2011 Mutations in TGFBR2 gene cause spontaneous cervical artery dissection.
21249319 2011 Expression of TGFß1 and its receptors is associated with biological features of ovarian cancer and sensitivity to paclitaxel/carboplatin.
21172820 2011 TbetaRI/Alk5-independent TbetaRII signaling to ERK1/2 in human skin cells according to distinct levels of TbetaRII expression.
21170488 2010 The role of the TGF-? coreceptor endoglin in cancer.
21131601 2011 Distinctive mechanism for sustained TGF-? signaling and growth inhibition: MEK1 activation-dependent stabilization of type II TGF-? receptors.
21098638 2010 Quantitative analysis of TGFBR2 mutations in Marfan-syndrome-related disorders suggests a correlation between phenotypic severity and Smad signaling activity.
21054789 2010 WFIKKN1 and WFIKKN2 bind growth factors TGF?1, BMP2 and BMP4 but do not inhibit their signalling activity.
20878063 2010 Abnormal expression of Endoglin and its receptor complex (TGF-?1 and TGF-? receptor II) as early angiogenic switch indicator in premalignant lesions of the colon mucosa.
20864512 2010 A panel of sputum-based genomic marker for early detection of lung cancer.
20860622 2010 DIP2 disco-interacting protein 2 homolog A (Drosophila) is a candidate receptor for follistatin-related protein/follistatin-like 1--analysis of their binding with TGF-? superfamily proteins.
20856203 2011 Critical role of endoglin in tumor cell plasticity of Ewing sarcoma and melanoma.
20840324 2011 Transforming growth factor ?-receptor II protein expression in benign prostatic hyperplasia is associated with prostate volume and inflammation.
20805453 2010 Molecular anatomy of breast cancer stroma and its prognostic value in estrogen receptor-positive and -negative cancers.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20701609 2010 MicroRNA-21 expression in neonatal blood associated with antenatal immunoglobulin E production and development of allergic rhinitis.
20662850 2011 Dural ectasia in individuals with Marfan-like features but exclusion of mutations in the genes FBN1, TGFBR1 and TGFBR2.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20628007 2010 TGFBR2 mutations alter smooth muscle cell phenotype and predispose to thoracic aortic aneurysms and dissections.
20621662 2010 Cigarette smoke-induced Egr-1 represses T beta R-II expression in human skin dermal fibroblasts.
20599261 2010 Gene-gene interaction in regulatory T-cell function in atopy and asthma development in childhood.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20565851 2010 Mutations in TGFbeta-RII and BAX mediate tumor progression in the later stages of colorectal cancer with microsatellite instability.
20518838 2010 Transforming growth factor beta receptor II (TGFBR2) polymorphisms and the association with nonsegmental vitiligo in the Korean population.
20457266 2011 Immunosuppressive cytokine gene polymorphisms and outcome after related and unrelated hematopoietic cell transplantation in a chinese population.
20428796 2010 Effect of the abrogation of TGF-beta1 by antisense oligonucleotides on the expression of TGF-beta-isoforms and their receptors I and II in isolated fibroblasts from keloid scars.
20410122 2010 Disrupted transforming growth factor-beta signaling in spinal and bulbar muscular atrophy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374083 2010 Transforming growth factor beta2 level is elevated in neurons of Alzheimer's disease brains.
20358619 2010 Germline TGF-beta receptor mutations and skeletal fragility: a report on two patients with Loeys-Dietz syndrome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20207738 2010 Ternary complex of transforming growth factor-beta1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily.
20197483 2010 Mesalazine reduces mutations in transforming growth factor beta receptor II and activin type II receptor by improvement of replication fidelity in mononucleotide repeats.
20165854 2010 Role of TGF-beta1, its receptor TGFbetaRII, and Smad proteins in the progression of colorectal cancer.
20160708 2010 Feedback between p21 and reactive oxygen production is necessary for cell senescence.
20157331 2010 SNPs in genes coding for ROS metabolism and signalling in association with docetaxel clearance.
20144264 2010 Mutations of the TGFBR2 gene in Chinese patients with Marfan-related syndrome.
20139972 2010 TGF-beta type II receptor phosphorylates PTH receptor to integrate bone remodelling signalling.
20101701 2010 Progressive aortic root and pulmonary artery aneurysms in a neonate with Loeys-Dietz syndrome type 1B.
20101206 2010 Extracellular matrix-induced transforming growth factor-beta receptor signaling dynamics.
20079749 2010 Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA.
20073064 2010 Reduction of transforming growth factor-beta type II receptor is caused by the enhanced ubiquitin-dependent degradation in human renal cell carcinoma.
20067791 2010 Nonsense-mediated translational repression involves exon junction complex downstream of premature translation termination codon.
19996017 2009 Comparison of clinical presentations and outcomes between patients with TGFBR2 and FBN1 mutations in Marfan syndrome and related disorders.
19959123 2009 Association of TGFBR2 polymorphism with risk of sudden cardiac arrest in patients with coronary artery disease.
19937272 2010 Expression of TGF-beta signaling factors in invasive breast cancers: relationships with age at diagnosis and tumor characteristics.
19916025 2010 Changes in expression, and/or mutations in TGF-beta receptors (TGF-beta RI and TGF-beta RII) and Smad 4 in human ovarian tumors.
19914962 2010 Absence of transforming growth factor-beta type II receptor is associated with poorer prognosis in HER2-negative breast tumours.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19888426 2009 Analysis of candidate genes in occurrence and growth of colorectal adenomas.
19886734 2010 Differences in the expression of glycosaminoglycans in human fibroblasts derived from gingival overgrowths is related to TGF-beta up-regulation.
19883511 2009 Loeys-Dietz syndrome type I and type II: clinical findings and novel mutations in two Italian patients.
19737884 2010 Trichostatin A-induced TGF-beta type II receptor expression in retinoblastoma cell lines.
19672284 2010 Association of the TGF-beta receptor genes with abdominal aortic aneurysm.
19639654 2009 Mutation of ACTA2 gene as an important cause of familial and nonfamilial nonsyndromatic thoracic aortic aneurysm and/or dissection (TAAD).
19626999 2009 [The expression and significance of TGF-beta 1 and its receptors in infertile women's fimbriae tubes with adhesions and atresias].
19624886 2009 [Correlations of TGF-betaRII, Smad4 and Smad7 expression to clinicopathologic characteristics and prognosis of gastric cancer].
19601999 2009 A genetic polymorphism in transforming growth factor beta receptor-2 is associated with serum osteopontin.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19548309 2009 TGFbetaR2 aberrant methylation is a potential prognostic marker and therapeutic target in multiple myeloma.
19542084 2009 Analysis of multigenerational families with thoracic aortic aneurysms and dissections due to TGFBR1 or TGFBR2 mutations.
19538865 2009 [Functional significance of TGF-beta1 signal transduction pathway in oral squamous cell carcinoma].
19533785 2009 Identification of novel FBN1 and TGFBR2 mutations in 65 probands with Marfan syndrome or Marfan-like phenotypes.
19503063 2009 Tumor-infiltrating lymphocytes in colorectal cancers with microsatellite instability are correlated with the number and spectrum of frameshift mutations.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19434696 2009 Possible association between genetic polymorphisms in transforming growth factor beta receptors, serum transforming growth factor beta1 concentration and abdominal aortic aneurysm.
19426152 2009 Acquired genetic and functional alterations associated with transforming growth factor beta type I resistance in Hep3B human hepatocellular carcinoma cell line.
19424605 2009 Association of gene polymorphisms with chronic kidney disease in high- or low-risk subjects defined by conventional risk factors.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19366699 2009 Bone morphogenetic protein (BMP) and activin type II receptors balance BMP9 signals mediated by activin receptor-like kinase-1 in human pulmonary artery endothelial cells.
19356148 2009 The extracellular domain of the TGFbeta type II receptor regulates membrane raft partitioning.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19335617 2009 Receptor expression modulates the specificity of transforming growth factor-beta signaling pathways.
19299629 2009 Sequencing of TGF-beta pathway genes in familial cases of intracranial aneurysm.
19293232 2009 Compensation of loss of protein function in microsatellite-unstable colon cancer cells (HCT116): a gene-dependent effect on the cell surface glycan profile.
19229971 2009 A case-control study of childhood acute lymphoblastic leukaemia and polymorphisms in the TGF-beta and receptor genes.
19193655 2009 TGF-beta1 inhibits expression and activity of hENT1 in a nitric oxide-dependent manner in human umbilical vein endothelium.
19161338 2009 TbetaR-II discriminates the high- and low-affinity TGF-beta isoforms via two hydrogen-bonded ion pairs.
19147499 2009 Different domains regulate homomeric and heteromeric complex formation among type I and type II transforming growth factor-beta receptors.
19088080 2009 Silencing of the transforming growth factor-beta (TGFbeta) receptor II by Kruppel-like factor 14 underscores the importance of a negative feedback mechanism in TGFbeta signaling.
19020727 2008 Soluble transforming growth factor beta type II receptor attenuates TGF-beta1 activity in human colorectal cancer LoVo cells.
19006214 2008 Paternal somatic mosaicism of a TGFBR2 mutation transmitting to an affected son with Loeys-Dietz syndrome.
18941508 2008 Mutation rates of TGFBR2 and ACVR2 coding microsatellites in human cells with defective DNA mismatch repair.
18829577 2008 Androgenic control of transforming growth factor-beta signaling in prostate epithelial cells through transcriptional suppression of transforming growth factor-beta receptor II.
18781618 2008 Identification of 23 TGFBR2 and 6 TGFBR1 gene mutations and genotype-phenotype investigations in 457 patients with Marfan syndrome type I and II, Loeys-Dietz syndrome and related disorders.
18724388 2008 Prostate tumor progression is mediated by a paracrine TGF-beta/Wnt3a signaling axis.
18721526 2008 Absence of TGFBR1 and TGFBR2 mutations in patients with bicuspid aortic valve and aortic dilation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18683732 2008 [Expression of TGF-beta receptors in CD8+ T cells of oral lichen planus].
18648910 2008 Effect of TGF-beta/Smad signaling on sertoli cell and possible mechanism related to complete sertoli cell-only syndrome.
18598696 2008 Analysis of the contribution of receptor subdomains to the cooperative binding and internalization of transforming growth factor-beta (TGF-beta) type I and type II receptors.
18550062 2009 ACE and TGFBR1 genes interact in influencing the susceptibility to abdominal aortic aneurysm.
18546940 2007 [The profile of expression of transforming growth factor beta1 and TGFbetaRI, TGFbetaRII and TGFbetaRIII genes in nasal polyps].
18514338 2008 Susceptible genes and molecular pathways related to heavy ion irradiation in oral squamous cell carcinoma cells.
18453574 2008 Activation of a TGF-beta-specific multistep gene expression program in mature macrophages requires glucocorticoid-mediated surface expression of TGF-beta receptor II.
18398939 2008 Abnormal transforming growth factor-beta expression in mesenchymal stem cells from patients with osteoarthritis.
18382895 2008 A novel truncated TGF-beta receptor II downregulates collagen synthesis and TGF-beta I secretion of keloid fibroblasts.
18339844 2008 Cancer-associated transforming growth factor beta type II receptor gene mutant causes activation of bone morphogenic protein-Smads and invasive phenotype.
18334936 2008 Localization of TGF-beta type II receptor and ED-A fibronectin in normal conjunctiva and failed filtering blebs.
18264665 2008 Absence of TGFBR2 mutations in patients with spontaneous spinal CSF leaks and intracranial hypotension.
18243111 2008 Cooperative assembly of TGF-beta superfamily signaling complexes is mediated by two disparate mechanisms and distinct modes of receptor binding.
18202754 2008 Loss of expression of TGF-beta1, TbetaRI, and TbetaRII correlates with differentiation in human oral squamous cell carcinomas.
18199825 2008 KSHV LANA inhibits TGF-beta signaling through epigenetic silencing of the TGF-beta type II receptor.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18097622 2008 Expression of TGF-beta1 and its receptor genes (TbetaR I, TbetaR II, and TbetaR III-betaglycan) in peripheral blood leucocytes in patients with idiopathic pulmonary arterial hypertension and Eisenmenger's syndrome.
18095113 2006 Mutational analysis of transforming growth factor-beta receptor type II and Smad3 tumor suppressor genes in prolactinomas.
18084123 2007 A Japanese family of typical Loeys-Dietz syndrome with a TGFBR2 mutation.
18053089 NFkappaB mediates IL-1beta-induced down-regulation of TbetaRII through the modulation of Sp3 expression.
18043895 2008 TGFbeta2 and TbetaRII are valid molecular biomarkers for the antiproliferative effects of tamoxifen and tamoxifen metabolites in breast cancer cells.
17985359 2008 Mutational inactivation of TGFBR2 in microsatellite unstable colon cancer arises from the cooperation of genomic instability and the clonal outgrowth of transforming growth factor beta resistant cells.
17950544 2007 Mutations of microsatellite instability target genes in sporadic basal cell carcinomas.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17878231 2007 Cholesterol suppresses cellular TGF-beta responsiveness: implications in atherogenesis.
17875924 2007 Mutant p53 attenuates the SMAD-dependent transforming growth factor beta1 (TGF-beta1) signaling pathway by repressing the expression of TGF-beta receptor type II.
17845732 2007 Alternative splicing of TGF-betas and their high-affinity receptors T beta RI, T beta RII and T beta RIII (betaglycan) reveal new variants in human prostatic cells.
17692120 2007 TGF-beta receptor 2 downregulation in tumour-associated stroma worsens prognosis and high-grade tumours show more tumour-associated macrophages and lower TGF-beta1 expression in colon carcinoma: a retrospective study.
17680270 2008 TGFB1 and TGFBR2 functional polymorphisms and risk of esophageal squamous cell carcinoma: a case-control analysis in a Chinese population.
17676583 2007 Expression of TGFbeta type-II receptor in association with markers of proliferation and apoptosis in premalignant lung lesions.
17676485 2007 TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 alterations are not associated with microsatellite instability or p53 mutations in invasive urothelial carcinoma of the urinary bladder.
17653092 2008 Lung adenocarcinoma invasion in TGFbetaRII-deficient cells is mediated by CCL5/RANTES.
17652900 2007 Phenotypic heterogeneity of Marfan-like connective tissue disorders associated with mutations in the transforming growth factor-beta receptor genes.
17637743 2008 Fibroblast growth factor-2 mediates transforming growth factor-beta action in prostate cancer reactive stroma.
17634290 2007 A unique element in the cytoplasmic tail of the type II transforming growth factor-beta receptor controls basolateral delivery.
17566598 2007 Defective expression of transforming growth factor beta type II receptor (TGFBR2) in the large cell variant of non-small cell lung carcinoma.
17562261 2007 [Correlations of polymorphisms of TGFB1 and TGFBR2 genes to genetic susceptibility to gastric cancer].
17560608 2008 TGFBR2 gene expression and genetic association with schizophrenia.
17471240 2007 GASDERMIN, suppressed frequently in gastric cancer, is a target of LMO1 in TGF-beta-dependent apoptotic signalling.
17470566 2007 Importance of the clinical recognition of Loeys-Dietz syndrome in the neonatal period.
17456004 2007 Selective translational repression of truncated proteins from frameshift mutation-derived mRNAs in tumors.
17427197 2007 D-glucose stimulation of L-arginine transport and nitric oxide synthesis results from activation of mitogen-activated protein kinases p42/44 and Smad2 requiring functional type II TGF-beta receptors in human umbilical vein endothelium.
17418587 2007 Genetic testing in patients with aortic aneurysms/dissections: a novel genotype/phenotype correlation?
17365852 2007 Platelets possess functional TGF-beta receptors and Smad2 protein.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17339425 2007 Resistance to TGF-beta 1 correlates with aberrant expression of TGF-beta receptor II in human B-cell lymphoma cell lines.
17330129 2007 Severe aortic and arterial aneurysms associated with a TGFBR2 mutation.
17319955 2007 Resequencing of genes for transforming growth factor beta1 (TGFB1) type 1 and 2 receptors (TGFBR1, TGFBR2), and association analysis of variants with diabetic nephropathy.
17270239 2007 TGFBR2 mutation is correlated with CpG island methylator phenotype in microsatellite instability-high colorectal cancer.
17194537 2007 Expression of TGF-betas and TGF-beta type II receptor in cerebrospinal fluid of patients with idiopathic normal pressure hydrocephalus.
17187359 2007 Variant alleles of TGFB1 and TGFBR2 are associated with a decreased risk of gastric cancer in a Chinese population.
17146441 2007 Modulation of the functional binding sites for TGF-beta on the type II receptor leads to suppression of TGF-beta signaling.
17117417 2007 Novel microdeletion in the transforming growth factor beta type II receptor gene is associated with giant and large cell variants of nonsmall cell lung carcinoma.
17112860 2006 Expression of transforming growth factor-beta receptor II mRNA in cyclosporine-induced gingival overgrowth.
17107667 2007 Epidermal growth factor up-regulates transforming growth factor-beta receptor type II in human dermal fibroblasts via p38 mitogen-activated protein kinase pathway.
17087113 2006 [Expression of transforming growth factor beta receptor I and II in chronic rhinosinusitis, nasal polyps and normal nasal mucosa tissues].
17086361 2006 Reduction of invasive potential in K-ras-transformed thyroid cells by restoring of TGF-beta pathway.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16982625 2006 Identification of Tctex2beta, a novel dynein light chain family member that interacts with different transforming growth factor-beta receptors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16928994 2006 Aneurysm syndromes caused by mutations in the TGF-beta receptor.
16885183 2006 Clinical features in a family with an R460H mutation in transforming growth factor beta receptor 2 gene.
16849474 2006 Anti-mitochondrial antibodies and primary biliary cirrhosis in TGF-beta receptor II dominant-negative mice.
16835936 2006 Comprehensive genetic analysis of relevant four genes in 49 patients with Marfan syndrome or Marfan-related phenotypes.
16824508 2006 Tgfbr2 regulates the maintenance of boundaries in the axial skeleton.
16733295 2006 Significant expression of endoglin (CD105), TGFbeta-1 and TGFbeta R-2 in the atherosclerotic aorta: an immunohistological study.
16673206 2006 Restoration of transforming growth factor-beta type II receptor reduces tumorigenicity in the human adrenocortical carcinoma SW-13 cell line.
16573164 2006 [Study on poly A site gene mutation of transforming growth factor-beta1 receptor type II between multiple and single site keloid].
16549496 2006 A "traffic control" role for TGFbeta3: orchestrating dermal and epidermal cell motility during wound healing.
16530041 2006 Emilin1 links TGF-beta maturation to blood pressure homeostasis.
16528739 2006 No major contribution of the TGFBR1- and TGFBR2-mediated pathway to Kabuki syndrome.
16428382 2006 Novel permissive role of epidermal growth factor in transforming growth factor beta (TGF-beta) signaling and growth suppression. Mediation by stabilization of TGF-beta receptor type II.
16388503 2006 Prostate cancer cells regulate growth and differentiation of bone marrow endothelial cells through TGFbeta and its receptor, TGFbetaRII.
16380996 2006 Influence of target gene mutations on survival, stage and histology in sporadic microsatellite unstable colon cancers.
16283890 2005 Identification of a novel TGFBR2 gene mutation in a Korean patient with Loeys-Dietz aortic aneurysm syndrome; no mutation in TGFBR2 gene in 30 patients with classic Marfan's syndrome.
16251899 2006 Two novel and one known mutation of the TGFBR2 gene in Marfan syndrome not associated with FBN1 gene defects.
16108056 2006 Proliferation and Cdk4 expression in microsatellite unstable colon cancers with TGFBR2 mutations.
16027248 2005 Mutations in transforming growth factor-beta receptor type II cause familial thoracic aortic aneurysms and dissections.
15976377 2005 Lung adenocarcinoma global profiling identifies type II transforming growth factor-beta receptor as a repressor of invasiveness.
15942678 2005 Remote delivery and expression of soluble type II TGF-beta receptor in muscle prevents hepatic fibrosis in rats.
15861007 2005 Molecular genetics of Marfan syndrome.
15856015 2005 Loss of TGF-beta type II receptor in fibroblasts promotes mammary carcinoma growth and invasion through upregulation of TGF-alpha-, MSP- and HGF-mediated signaling networks.
15824172 2005 Genotyping of patients with sporadic and radiation-associated meningiomas.
15811425 2005 Alteration of the TGF-beta/SMAD pathway in intrinsically and UV-induced skin aging.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15731757 2005 A syndrome of altered cardiovascular, craniofacial, neurocognitive and skeletal development caused by mutations in TGFBR1 or TGFBR2.
15702480 2005 Interaction and functional interplay between endoglin and ALK-1, two components of the endothelial transforming growth factor-beta receptor complex.
15647279 2005 Trichostatin A induces transforming growth factor beta type II receptor promoter activity and acetylation of Sp1 by recruitment of PCAF/p300 to a Sp1.NF-Y complex.
15522964 2005 Thrombin induces endocytosis of endoglin and type-II TGF-beta receptor and down-regulation of TGF-beta signaling in endothelial cells.
15356634 2004 Cytoplasmic PML function in TGF-beta signalling.
15350299 2004 Multiple epithelial and nonepithelial tumors in hereditary nonpolyposis colorectal cancer: characterization of germline and somatic mutations of the MSH2 gene and heterogeneity of replication error phenotypes.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15305380 2004 Polymorphisms and haplotype structures in genes for transforming growth factor beta1 and its receptors in familial and unselected breast cancers.
15235604 2004 Heterozygous TGFBR2 mutations in Marfan syndrome.
15146427 2004 An increased transforming growth factor beta receptor type I:type II ratio contributes to elevated collagen protein synthesis that is resistant to inhibition via a kinase-deficient transforming growth factor beta receptor type II in scleroderma.
15102771 2004 Down-modulation of lung immune responses by interleukin-10 and transforming growth factor beta (TGF-beta) and analysis of TGF-beta receptors I and II in active tuberculosis.
15017149 2004 Sequential resonance assignments of the extracellular domain of the human TGFbeta type II receptor in complex with monomeric TGFbeta3.
15009106 2004 Genetic susceptibility to keloid disease: transforming growth factor beta receptor gene polymorphisms are not associated with keloid disease.
14976186 2004 Unique and selective effects of five Ets family members, Elf3, Ets1, Ets2, PEA3, and PU.1, on the promoter of the type II transforming growth factor-beta receptor gene.
14760070 2004 Prognostic significance of transforming growth factor beta receptor II in estrogen receptor-negative breast cancer patients.
14727154 2004 LRP5, low-density-lipoprotein-receptor-related protein 5, is a determinant for bone mineral density.
14704634 2004 Expression of TGF beta1 genes and their receptor types I, II, and III in low- and high-grade malignancy non-Hodgkin's lymphomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14601051 2003 Expression of TGF-beta type II receptor antisense RNA impairs TGF-beta signaling in vitro and promotes mammary gland differentiation in vivo.
14582709 2003 Effect of ets-related transcription factor (ERT) on transforming growth factor (TGF)-beta type II receptor gene expression in human cancer cell lines.
12970754 2003 Genomic profiling identifies alterations in TGFbeta signaling through loss of TGFbeta receptor expression in human renal cell carcinogenesis and progression.
12941698 2003 TLP, a novel modulator of TGF-beta signaling, has opposite effects on Smad2- and Smad3-dependent signaling.
12939140 2003 Solution structure and backbone dynamics of the TGFbeta type II receptor extracellular domain.
12915548 2003 Transforming growth factor beta1 receptor II is downregulated by E1A in adenovirus-infected cells.
12873459 2003 Genetic susceptibility to Dupuytren's disease: transforming growth factor beta receptor (TGFbetaR) gene polymorphisms and Dupuytren's disease.
12840808 2003 Roles of the conserved CCAAT and GC boxes of the human and mouse type II transforming growth factor-beta receptor genes.
12825850 2003 Higher stromal expression of transforming growth factor-beta type II receptors is associated with poorer prognosis breast tumors.
12821554 2003 Mapping a locus for familial thoracic aortic aneurysms and dissections (TAAD2) to 3p24-25.
12736050 2003 Loss of expression of transforming growth factor-beta receptor as a prognostic factor in patients with renal cell carcinoma.
12729750 2003 Transforming growth factor-beta (TGF-beta) binding to the extracellular domain of the type II TGF-beta receptor: receptor capture on a biosensor surface using a new coiled-coil capture system demonstrates that avidity contributes significantly to high affinity binding.
12607775 2002 Transforming growth factors beta1, beta2 and beta3 and their receptors are differentially expressed in human peritoneal fibroblasts in response to hypoxia.
12515396 2002 Catheter-based adenovirus-mediated local intravascular gene delivery of a soluble TGF-beta type II receptor using an infiltrator in porcine coronary arteries: efficacy and complications.
12479849 2003 Microsatellite mutations of transforming growth factor-beta receptor type II and caspase-5 occur in human precursor T-cell lymphoblastic lymphomas/leukemias in vivo but are not associated with hMSH2 or hMLH1 promoter methylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429842 2002 Transforming growth factor-beta receptors interact with AP2 by direct binding to beta2 subunit.
12421567 2002 Co-evolutionary analysis reveals insights into protein-protein interactions.
12215842 2002 Differential rates of frameshift alterations in four repeat sequences of hereditary nonpolyposis colorectal cancer tumors.
12202987 2002 A catalog of 106 single-nucleotide polymorphisms (SNPs) and 11 other types of variations in genes for transforming growth factor-beta1 (TGF-beta1) and its signaling pathway.
12174910 Transforming growth factor beta type II receptor expression in gastric cancer: evidence for two independent subgroups.
12145287 2002 Hyaluronan promotes signaling interaction between CD44 and the transforming growth factor beta receptor I in metastatic breast tumor cells.
12121646 2002 The 1.1 A crystal structure of human TGF-beta type II receptor ligand binding domain.
12077447 2002 Crystallization and preliminary crystallographic studies of human TGF-beta type II receptor ligand-binding domain.
12060054 2002 Transforming growth factor-beta 1, 2, 3 and receptor type I and II in diabetic foot ulcers.
12017275 A novel dominant negative Smad2 mutation in a TGFbeta resistant human carcinoma cell line.
12015308 2002 Extracellular and cytoplasmic domains of endoglin interact with the transforming growth factor-beta receptors I and II.
12000714 2002 Interaction between the transforming growth factor-beta type II receptor/Smad pathway and beta-catenin during transforming growth factor-beta1-mediated adherens junction disassembly.
11850637 2002 Crystal structure of the human TbetaR2 ectodomain--TGF-beta3 complex.
11820800 2002 1 alpha,25-dihydroxyvitamin D3 increases TGF beta 1 binding to human osteoblasts.
11781097 2002 Eukaryotic initiation factor 2 alpha subunit associates with TGF beta receptors and 14-3-3 epsilon and acts as a modulator of the TGF beta response.
11741970 2002 RhoB, not RhoA, represses the transcription of the transforming growth factor beta type II receptor by a mechanism involving activator protein 1.
11483955 2001 TGF-beta-induced apoptosis is mediated by the adapter protein Daxx that facilitates JNK activation.
11387212 2001 The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway.
11382746 2001 Real-time monitoring of the interactions of transforming growth factor-beta (TGF-beta ) isoforms with latency-associated protein and the ectodomains of the TGF-beta type II and III receptors reveals different kinetic models and stoichiometries of binding.
11323414 2001 Functional roles for the cytoplasmic domain of the type III transforming growth factor beta receptor in regulating transforming growth factor beta signaling.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11278302 2001 Transforming growth factor-beta receptor-associated protein 1 is a Smad4 chaperone.
11278251 2001 Smurf1 interacts with transforming growth factor-beta type I receptor through Smad7 and induces receptor degradation.
11251969 2001 Association between CagA+ Helicobacter pylori infection and p53, bax and transforming growth factor-beta-RII gene mutations in gastric cancer patients.
11212236 2001 Inhibiting mutations in the transforming growth factor beta type 2 receptor in recurrent human breast cancer.
11163210 2000 Smad7 binds to Smurf2 to form an E3 ubiquitin ligase that targets the TGF beta receptor for degradation.
11158177 2001 Germline mutation analysis of the transforming growth factor beta receptor type II (TGFBR2) and E-cadherin (CDH1) genes in early onset and familial colorectal cancer.
11157754 2001 Type III TGF-beta receptor-independent signalling of TGF-beta2 via TbetaRII-B, an alternatively spliced TGF-beta type II receptor.
11100470 2001 Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.
10789724 2000 A dominant negative mutation of transforming growth factor-beta receptor type II gene in microsatellite stable oesophageal carcinoma.
10716993 2000 Activin receptor-like kinase 1 modulates transforming growth factor-beta 1 signaling in the regulation of angiogenesis.
10508522 1999 Repression of the gene encoding the TGF-beta type II receptor is a major target of the EWS-FLI1 oncoprotein.
10207840 1999 Expression of transforming growth factor-beta receptors types II and III within various cells in the rat periodontium.
10092230 1999 Requirement of type III TGF-beta receptor for endocardial cell transformation in the heart.
9927040 1999 Mutational inactivation of transforming growth factor beta receptor type II in microsatellite stable colon cancers.
9926943 1999 Functional association of TGF-beta receptor II with cyclin B.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9865696 1998 SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.
9856985 1998 Identification of STRAP, a novel WD domain protein in transforming growth factor-beta signaling.
9590282 1998 HNPCC associated with germline mutation in the TGF-beta type II receptor gene.
9472030 1998 Oligomeric structure of type I and type II transforming growth factor beta receptors: homodimers form in the ER and persist at the plasma membrane.
9435577 1997 TGF-beta 1 modulates EGF-stimulated phosphatidylinositol 3-kinase activity in human airway smooth muscle cells.
9169454 1997 The type II transforming growth factor-beta receptor autophosphorylates not only on serine and threonine but also on tyrosine residues.
9155023 1997 Positive and negative regulation of type II TGF-beta receptor signal transduction by autophosphorylation on multiple serine residues.
9045666 1997 Processing of the transforming growth factor beta type I and II receptors. Biosynthesis and ligand-induced regulation.
8973329 1996 Cloning of a cDNA encoding the human transforming growth factor-beta type II receptor: heterogeneity of the mRNA.
8947046 1996 Phosphorylation of Ser165 in TGF-beta type I receptor modulates TGF-beta1-induced cellular responses.
8840968 1996 Genomic structure of the transforming growth factor beta type II receptor gene and its mutations in hereditary nonpolyposis colorectal cancers.
8812462 1996 The genomic structure of the gene encoding the human transforming growth factor beta type II receptor (TGF-beta RII).
8774881 1996 Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.
8622651 1996 Activation of signalling by the activin receptor complex.
8576253 1996 Identification of important regions in the cytoplasmic juxtamembrane domain of type I receptor that separate signaling pathways of transforming growth factor-beta.
8555189 1996 Interaction of transforming growth factor beta receptors with apolipoprotein J/clusterin.
8388126 1993 Inactivation of the type II receptor reveals two receptor pathways for the diverse TGF-beta activities.
8317497 1993 Autosomal dominant Marfan-like connective-tissue disorder with aortic dilation and skeletal anomalies not linked to the fibrillin genes.
8242742 1993 Identification of human activin and TGF beta type I receptors that form heteromeric kinase complexes with type II receptors.
8106553 1994 Betaglycan can act as a dual modulator of TGF-beta access to signaling receptors: mapping of ligand binding and GAG attachment sites.
8020936 1994 Transforming growth factor receptor gene TGFBR2 maps to human chromosome band 3p22.
7959019 1994 A cDNA encoding the human transforming growth factor beta receptor suppresses the growth defect of a yeast mutant.
7935686 1994 Transforming growth factor beta in tissue fibrosis.
7890683 1995 Cloning of a novel type II serine/threonine kinase receptor through interaction with the type I transforming growth factor-beta receptor.
7852346 1995 The soluble exoplasmic domain of the type II transforming growth factor (TGF)-beta receptor. A heterogeneously glycosylated protein with high affinity and selectivity for TGF-beta ligands.
7774578 1995 GS domain mutations that constitutively activate T beta R-I, the downstream signaling component in the TGF-beta receptor complex.
7761852 1995 Inactivation of the type II TGF-beta receptor in colon cancer cells with microsatellite instability.
7632217 1994 A second locus for Marfan syndrome maps to chromosome 3p24.2-p25.
7566156 1995 A WD-domain protein that is associated with and phosphorylated by the type II TGF-beta receptor.
1525823 1992 Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase.
1333888 1992 TGF beta signals through a heteromeric protein kinase receptor complex.
1326540 1992 Endoglin is a component of the transforming growth factor-beta receptor system in human endothelial cells.
1319842 1992 Receptors for the TGF-beta family.
1310899 1992 Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase.