Property Summary

Ligand Count 291
NCBI Gene PubMed Count 392
PubMed Score 847.94
PubTator Score 479.94

Knowledge Summary

Patent (30,289)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 5.0
Thoracic aortic aneurysm 15 0.0 5.0

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.546 1.2e-02
active ulcerative colitis 1.008 1.0e-02
acute quadriplegic myopathy 1.235 2.7e-05
adult high grade glioma 1.800 1.3e-03
astrocytoma 1.300 8.0e-14
Astrocytoma, Pilocytic 2.000 5.8e-07
Breast cancer 2.100 4.5e-02
ependymoma 1.200 1.7e-02
Gaucher disease type 1 -1.600 1.9e-02
glioblastoma 1.900 2.8e-10
group 3 medulloblastoma 2.700 5.2e-04
intraductal papillary-mucinous adenoma (... 1.600 3.0e-02
juvenile dermatomyositis 1.132 1.6e-10
medulloblastoma, large-cell 2.200 5.7e-04
oligodendroglioma 1.100 4.1e-08
osteosarcoma 2.403 9.5e-04
ovarian cancer 1.400 2.2e-02
pancreatic cancer 1.600 2.6e-02
primitive neuroectodermal tumor 2.000 4.6e-05

Synonym

Accession P36897 Q6IR47 Q706C0 Q706C1 TGFR-1
Symbols AAT5
ALK5
ESS1
LDS1
MSSE
SKR4
TBRI
ALK-5
LDS1A
LDS2A
TBR-i
TGFR-1
ACVRLK4
tbetaR-I

Gene

Protein-protein Interaction (3)

PDB (32)

Gene RIF (322)

AA Sequence

MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSM      1 - 70
CIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCIS     71 - 140
LMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQES    141 - 210
IGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVS    211 - 280
DYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIA    281 - 350
DLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI    351 - 420
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKK    421 - 490
TLSQLSQQEGIKM                                                             491 - 503
//

Text Mined References (399)

PMID Year Title