Property Summary

NCBI Gene PubMed Count 185
PubMed Score 852.47
PubTator Score 575.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.400 2.5e-02
group 3 medulloblastoma 1.700 4.9e-04
ductal carcinoma in situ 1.100 4.5e-02
Breast cancer -1.300 7.4e-04

Protein-protein Interaction (1)

Gene RIF (145)

PMID Text
26653761 TGFbeta signaling via both SMAD2/7 and PARD6/SMURF1 pathways plays a role in trophoblast growth and differentiation.
26612435 TGFB3 polymorphism is associated with male infertility.
26555637 CCN4 has a positive influence on chondrogenic differentiation by modulating the effects of TGF-beta3.
26298390 Our study uncovers the PITX2-induced expression of TGFB1/2/3 as well as INHBA genes (p < 0.01) followed by SMAD2/3-dependent TGF-b signalling pathway in ovarian cancer cells
26184463 Results identified a novel human TGFB3 mutation, which contributes to the clinical delineation of the emerging connective tissue disorder tentatively called Rienhoff syndrome, a disorder overlapping with Marfan and Loeys-Dietz syndrome.
25858630 TGF-beta3 mediates the attenuating effect of MSCs on both the proliferation and extracellular matrix production of human keloid fibroblasts and decreases skin fibrosis
25835445 findings emphasize the broad clinical variability associated with TGFB3 mutations and highlight the importance of early recognition of the disease because of high cardiovascular risk
25753754 Fluocinolone Acetonide enhances TGF-beta3-associated chondrogenesis of bone marrow derived mesenchymal stem cells
25743244 TGFbeta1 and TGFbeta2 appeared to play a significant role in physiological and pathological conditions in the fetus.
25742744 TGF-beta3 existed in synovium and LBs of SC, and was responsible for the pathogenesis of SC.
25695838 TGF-beta3-expressing CD4+CD25(-)LAG3+ regulatory T cells have a role in controlling humoral immune responses
25633651 There was no association between TGF-beta gene polymorphisms and juvenile-onset systemic lupus erythematosus in an Iranian cohort.
25431043 TGF-beta3 may contribute to the persistent intestinal dysfunction seen in gastroschisis-related intestinal dysfunction.
25418724 Data indicate greater staining for transforming growth factor beta 3 (TGF-beta3) in healthier tissue compared with diseased menisci.
25383667 Crystal structures, mutations and peptide-affinity measurements show that alpahVbeta6 binds with high affinity to a RGDLXXL/I motif within the prodomains of TGF-beta1 and TGF-beta3.
25307808 TGFB3 polymorphism, significant differences were observed for allele and genotype frequencies between caries free and caries affected individuals in oral cleft group (p = 0.013 and 0.006 for allele and genotype frequencies respectively).
25257729 The results show an intricate interplay between p53 and TGF-beta3 whereby p53 inhibits the TGF-beta3-induced expression of genes, e.g., EPHB2, to impede tumor cell invasion and migration
24907658 It was found that the majority of TGF-beta3 that was loaded onto the scaffold was released in a controlled manner over the first 10days of culture, with comparable long-term chondrogenesis
24825427 Liarozole decreased TGF-beta3 and TGF-beta3-mediated extracellular matrix expression in a 3D uterine leiomyoma culture system.
24635173 We identified genetic variants in TGFB3 and ARHGAP29 associated with suboptimal healing outcome.
24551192 Antibodies against TGF-beta or a TGF-beta receptor inhibitor SB431452 reverse HIV-1 Vpu-mediated profibrogenic activation of LX2 cells, suggesting that TGF-beta mediates these effects
24438909 These results unequivocally demonstrate that human TGF-beta3 elicits bone induction by up-regulation of endogenous BMP-2 and is blocked by hNoggin.
24402195 Compared to controls, plasma levels of TGF-beta1 and TGF-beta2 were significantly lower in patients with recurrent VTE (p < 0.05), whereas no difference was found for TGF-beta3.
24306208 This study provides a comprehensive list of genes differentially expressed in the healing corneal epithelial cells of diabetic corneas and suggests the therapeutic potential of TGF-beta3 for treating corneal and skin wounds in diabetic patients.
24056369 Transforming growth factor-beta3 (TGF-beta3) knock-in ameliorates inflammation due to TGF-beta1 deficiency while promoting glucose tolerance.
24053560 meta-analysis suggests that TGF-beta3 gene polymorphisms may contribute to NSCLP susceptibility, especially among Asian populations.
23968981 Shear stress of vascular endothelial cells induces TGF-beta3 signaling and subsequent activation of Kruppel-like factor 2 and NO, and represents a novel role for TGF-beta3 in the maintenance of homeostasis in a hemodynamic environment.
23824657 Mutation in TGFB3 is associated with a syndrome of low muscle mass, growth retardation, distal arthrogryposis and clinical features overlapping with Marfan and Loeys-Dietz syndrome.
23122986 These findings suggest human serum, FGF-2 and TGF-beta3 as possible candidates to support biological treatment strategies of AF defects.
23023602 The GG genotype and G allele of TGF-beta 3 were significantly different in the patient group compared with the control.
22880017 These results highlight TGFbeta/5-HT signaling as a potent mechanism for control of biomechanical remodeling of atrioventricular cushions during development.
22796605 IL-1B & TGFB3 synergistically activated MMP)-1, MMP-3,& MMP-10 gene expression in NSCLC cells via MAPK-dependent pathways.
22795539 SOX9 gene plus heparinized TGF-beta 3 coated dexamethasone loaded PLGA microspheres induce chondrogenesis of hMSCs
22706080 TGF-beta3 isoform is a key agent in seminal plasma that signals induction of proinflammatory cytokine synthesis in cervical cells.
22674391 Hypoxia may inhibit the invasion of human extravillous trophoblast cells through inducing the integrin switch from alpha1 integrin to alpha5 integrin and promoting TGFB3 expression.
22464821 The aim of the study was to determine temporal TGFB1, TGFB2 and TGFB3 gene expression profiles in the anterior lens capsule of paediatric patients with posttraumatic cataract.
22409215 analysis of genetic variants hints at the contribution of TGFB3 and MN1 in the aetiology of submucous cleft palate
22369552 involved in the modulation of epithelial barrier function by regulating assembly of tight junctions
22266274 We observed significant downregulation of Transforming Growth Factor beta 3 in women with recurrent miscarriage compared with controls.
22191848 Significant statistical differences were found for genotype frequencies between tooth agenesis and TGFB3 control samples, as well as for allele and genotype frequencies between unilateral tooth agenesis and TGFB3 control samples.
22143699 This study confirms the crucial role of TGF-beta3 in the fusion of palatal shelves during development and further, provides novel evidence of TGF-beta3 gene polymorphism in the etiology of nonsyndromic cleft lip and palate in Indian subpopulation
21823016 TGF-beta3 could be stably expressed in pcDNA3.1(+)-hTGF-beta3-transfected PSCs.
21666950 study suggests that both combination medium, but better with the addition of TGF-ss3 could enhance BMSCs chondrogenesis in vivo, and promotes themaintenance of the chondrocyte phenotype
21611961 TGF-beta, besides acting as an inhibitor, also can, by dampening the noggin-mediated negative-feedback loop, enhance BMP-induced osteoblast differentiation.
21423151 These results provide evidence that the two TbetaRI:TbetaRII heterodimers bind and mediate TGF-beta3 signalling.
21411746 Data show that TGF-beta pathways operate during ovarian fetal development, and fibrillin 3 is highly expressed at a critical stage early in developing human and bovine fetal ovaries.
21352603 The restoration of the expression of TbetaRII and TbetaRIII in oral cancerous tissues may represent a novel strategy for the treatment of oral carcinoma.
21305699 TGFbeta subtypes (1, 2 and 3) affect terminal differentiation of in vitro cultured hBMSCs differently
21177256 MSX1 and TGF-beta3 are direct targets of FOXE1.
21084396 Leiomyoma-secreted TGF-beta3 induces bone morphogenetic protein 2 resistance in endometrium by down-regulation of bone morphogenetic protein receptor 2, likely causing defective endometrial decidualization
21041550 A susceptibility locus was identified on chromosome 14q24.3-31.2. The candidate functional gene is TGFB3. A suggestive linkage for mandibular prognathism in a Han Chinese pedigree.
20945347 TGFbeta1 and TGFbeta3 play separate yet complimentary roles in achieving cell cycle arrest and EMT/apoptosis and cell cycle arrest is a prerequisite for later cellular changes in palate development.
20736064 Mesenchymal stem cells and bone marrow-derived mononuclear cells can generate tendon-like tissue in 7 days mediated by transforming growth factor beta3.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20613589 TGF-B3 was upregulated in early and late osteogenesis in microarray and qRT analyses and demonstrated the largest increase in expression when compared with day 1.
20587546 Observational study of gene-disease association. (HuGE Navigator)
20572854 Observational study of gene-disease association. (HuGE Navigator)
20497023 Results indicate that that levels of TGF-beta1 and TGF-beta3 mRNAs were significantly higher in lungs of chemical gas-injured patients.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20408761 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20407224 TGF-beta1 and TGF-beta3 similarly enhance terminal differentiation in an in vitro hypertrophy model of chondrogenically differentiating mesenchymal stem cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237132 CYR61 and NOV are regulated by HIF-1alpha and TGF-beta3 in the trophoblast cell line JEG3, and their enhanced secretion could be implicated in appropriate placental invasion.
20170386 Allelic and haplotypic associations implicate a possible role of TGFB3 in nonsyndromic cleft lip with or without cleft palate in the Chilean population.
20170386 Observational study of gene-disease association. (HuGE Navigator)
20142847 TGF-beta1, TGF-beta2, and TGF-beta3 mRNAs were detected in both normal and pseudophakic bullous keratopathy (PBK) corneas.
20083094 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20082468 MTHFR, TGFB3, and TGFA polymorphisms have roles in non-syndromic cleft lip and cleft palate in different regions of China
20082468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19937272 Our data provide evidence that TGF-beta signaling patterns vary by age and pathologic features of prognostic significance including ER expression.
19897194 Observational study of gene-disease association. (HuGE Navigator)
19787410 TGF-beta3 may regulate taste epithelial cell homeostasis through controlling cell proliferation.
19700613 Aberrant production of excessive and disorganized extracellular matrix in uterine leiomyoma involves the activation of the TGF-beta3 signaling pathway and excessive production of GAG-rich versican variants.
19656717 Studies indicated that TGF-beta3 may actually play a protective role against tumourigenesis in a range of tissues including the skin, breast, oral and gastric mucosa.
19651533 Studies indicate that TNFalpha and TGFbeta3 are present at high levels in the microenvironment of the seminiferous epithelium during spermatogenesis.
19628198 A fetal TGF-beta3 polymorphism (rs1146414) is associated with pregnancy-induced hypertension in a predominantly Hispanic population.
19628198 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19432813 TGF-beta type I receptor inhibitor LY364947 blocked the up-regulation on TGF-beta(1) and TGF-beta(3) production stimulated by mechanical load, and also blocked the chondrogenesis of human mesenchymal stem cells.
19396528 6 breast cancer studies show a negative correlation between TGF-beta3 mRNA levels & increasing tumor grade. High expression of TGF-beta3 mRNA is associated with good outcomem suggesting a protective role. Review.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19328471 TGF-beta3 induced a molecular phenotype in myometrial cells that was similar to leiomyoma cells, with elevated production of extracellular matrix (ECM)-related genes and decreased production of ECM degradation-related genes.
19231643 Overexpression of TGF-beta3 and extracellular matrix proteins may represent antecedent tissue repair and therefore may be considered a significant event in the resolution of acquired reactive perforating collagenosis lesions
19212830 Report expression of decorin in esophageal cancer in relation to the expression of three isoforms of transforming growth factor-beta (TGF-beta1, -beta2, and -beta3) and matrix metalloproteinase-2 activity.
19161338 High-affinity binding of TGF-beta1/3 to TGF-betaRII is primarily due to hydrogen bonding between Arg25 and 94 of TGF-beta1/3, and Glu119 and Asp32 of TbetaR-II. Arg25 and 94 are substituted by Lys in TGF-beta2, which binds with low affinity to TbetaR-II.
19107876 the combination of daily loading and TGFbeta(3) administration produced superior osteocyte survival at the core centres when compared to loading or TGFbeta alone.
19062040 TGF-beta cytokines may be involved in postsurgical adhesion formation
18976975 Knockdown of transforming growth factor, beta 3 (TGFB3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18950289 BMP-2 enhances TGF-beta3-mediated chondrogenesis of mesenchymal stromal cells.
18799618 Snail and Slug promote formation of beta-catenin-T-cell factor (TCF)-4 transcription complexes that bind to the promoter of the TGF-beta3 gene to increase its transcription.
18698632 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18505915 the TGF-beta1-2-3/Smad3 pathway has a role in mediating ovarian oncogenesis by enhancing metastatic potential
18498721 study found different expression of the TGF-beta1, -2 and -3 isoforms in the human corneal epithelium; such differential expression of TGF-betas suggests that each of them may play a specific role in corneal tissue
18480962 Data support the involvement of TGFB3 in the development of oral clefts in patients among 204 triads of central European origin.
18480962 Observational study of gene-disease association. (HuGE Navigator)
18293167 Observational study of gene-disease association. (HuGE Navigator)
18243111 TGF-beta complexes assemble cooperatively through recruitment of the low-affinity (type I) receptor by the ligand-bound high-affinity (type II) pair.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18156205 oxygen regulates the placental expression of endoglin via TGF-beta 3
18080134 TGF-beta 3 was detected from the canalisation stage of the salivary gland, being weakly expressed on ductal cells, and it was the only factor detected on myoepithelial cells.
18078367 TGF-beta 3 is closely related to mineral maturation matrix in human developing teeth
18049952 There is a significantly elevated concentration of TGF-beta3 in PE eyes
18039789 TGF-beta2 and -beta3 are differentially expressed during the menstrual cycle and regulated by progesterone in epithelial vs stromal cells.
17673689 collagen I induces EMT in lung cancer cells by activating autocrine TGF-beta3 signaling. Epidermal growth factor also seems to initiate EMT via a TGF-dependent mechanism.
17671384 TGF-beta3 may play a role as regulator of variety of cellular events during HELLP syndrome. High local expression may be responsible for remodeling of the placental structure resulting in dysfunction of maternal-fetal circulation.
17401695 BMP-2, TGF-beta2, and TGF-beta3 are involved in bone formation in heterotopic ossifications.
17272867 Observational study of gene-disease association. (HuGE Navigator)
17225872 Altered crosstalk between RA, GABAergic, and TGF-beta signaling systems could be involved in human cleft palate fibroblast phenotype.
16930538 CD24 regulates E-cadherin and TGF-beta3 expression in cultured oral epithelial cells
16781676 Hunchback sequence binding protein may function as a TGF-beta3 gene transcriptional regulator and may be expressed in a cell type-specific manner.
16778279 Observational study of gene-disease association. (HuGE Navigator)
16549496 Depletion of TGFbeta3 from serum converts serum to a plasmalike reagent.
16247549 Observational study of gene-disease association. (HuGE Navigator)
16210002 TGF-beta 3 may promote endometrial tissue repair through the inhibition of the proliferation, expansion, and migration of endometrial stromal cells, and through stimulation of contraction of the collagen gel matrix by these cells.
16043141 Observational study of gene-disease association. (HuGE Navigator)
15924806 No association was found between TGF-beta3 gene polymorphisms essential hypertension in Chinese.
15924806 Observational study of gene-disease association. (HuGE Navigator)
15896309 Human TGF-beta2 but not human TGF-beta1, or -beta3 promotes cardiac myocyte differentiation from mouse ES cells.
15639475 We identified TGFbeta3 as the disease gene involved in ARVD1.
15155569 regulation of TGF-beta3 promoter activity by HIF-1 represents a mechanism for trophoblast differentiation during hypoxia.
15017149 NMR analysis of the extracellular domain of the human TGFbeta type II receptor in complex with monomeric TGFbeta3
14659070 Observational study of gene-disease association. (HuGE Navigator)
12911534 All three TGF-beta isoforms have fibrogenic effects on renal cells. TGF-beta2 and TGF-beta3 effects may be partially mediated by TGF-beta1. Blockade of all isoforms together may yield best therapeutic effect in reducing renal fibrosis.
12772773 Glucocorticoids significantly inhibited TGF-beta1 and TGF-beta2 production and reduced expression of the up-regulated TGF-beta1 and TGF-beta2 mRNA induced by exogenous TGF-beta1, -beta2, or -beta3
12733956 Observational study of gene-disease association. (HuGE Navigator)
12733956 positively associated with cleft lip and/or palate with hypodontia outside the cleft region
12652527 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12651933 mutations make a contribution to clefts in South American populations
12607775 TGF-beta3 expression in peritoneal fibroblasts was not affected by hypoxia or TGF-beta1 stimulation
12489185 investigated TGF-beta 1, -beta 2, and -beta 3 latency-associated peptides (LAP)expression in sound and carious human teeth
12432546 The role of TGF-beta1 and -beta3 in generating a high TIFP was investigated in xenografted experimental anaplastic thyroid carcinoma (ATC) derived from the human ATC cell line
12410804 children with active celiac disease have an altered expression of TGF-beta1 and TGF-beta3 in the small intestine
12221089 determination of the importance of conformational entropy in the interaction of TGF-beta3 with the receptors
12171249 TGFbeta3 regulates GM-CSF induced human myelopoiesis
12168782 TGFbeta3 may have a role in mediating progesterone- and progestogen-induced endometrial differentiation
12060054 present in diabetic foot ulcer
12021923 TGF-beta1, TGF-beta2 and TGF-beta3 isoforms are produced by chondrosarcomas and could have a potential role as autocrine growth stimulators in these neoplasms
11969342 downregulation of TGF-beta 3 expression found in pre-eclamptic umbilical cord may contribute to the abnormal structure and mechanical properties seen in these pathological umbilical cords
11850637 crystal structure of the human TbetaR2 ectodomain--TGF-beta3 complex
11776328 PAI-1 gene activation by TNF-alpha apparently is yet to be defined for the location of the response element and/or the signaling pathway, while TGF-beta is the most important cytokine for PAI-1 transcriptional activation through its 5' proximal promoter.
11754469 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11384957 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVL      1 - 70
ALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVE     71 - 140
KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVRE    141 - 210
WLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLIL    211 - 280
MMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY    281 - 350
LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS            351 - 412
//

Text Mined References (185)

PMID Year Title
26653761 2016 Aberrant TGF? Signaling Contributes to Altered Trophoblast Differentiation in Preeclampsia.
26612435 2015 TGF?3 (TGFB3) polymorphism is associated with male infertility.
26555637 2016 CCN4/WISP-1 positively regulates chondrogenesis by controlling TGF-?3 function.
26315405 2015 XBP 1-Deficiency Abrogates Neointimal Lesion of Injured Vessels Via Cross Talk With the PDGF Signaling.
26298390 2015 Invasion of ovarian cancer cells is induced byPITX2-mediated activation of TGF-? and Activin-A.
26184463 2015 Exome sequencing identifies a novel heterozygous TGFB3 mutation in a disorder overlapping with Marfan and Loeys-Dietz syndrome.
25858630 2015 Mesenchymal stem cells suppress fibroblast proliferation and reduce skin fibrosis through a TGF-?3-dependent activation.
25835445 2015 Mutations in a TGF-? ligand, TGFB3, cause syndromic aortic aneurysms and dissections.
25753754 2015 Fluocinolone Acetonide Is a Potent Synergistic Factor of TGF-?3-Associated Chondrogenesis of Bone Marrow-Derived Mesenchymal Stem Cells for Articular Surface Regeneration.
25743244 2015 Constitutively high-level expression of TGF? isoforms in cord blood and its relationship to perinatal findings.
25742744 2015 Transforming growth factor beta 3 involved in the pathogenesis of synovial chondromatosis of temporomandibular joint.
25695838 2015 TGF-?3-expressing CD4+CD25(-)LAG3+ regulatory T cells control humoral immune responses.
25633651 2015 Lack of association between interleukin-10, transforming growth factor-beta gene polymorphisms and juvenile-onset systemic lupus erythematosus.
25431043 2015 Transforming growth factor-beta 3 alters intestinal smooth muscle function: implications for gastroschisis-related intestinal dysfunction.
25418724 2014 Human migratory meniscus progenitor cells are controlled via the TGF-? pathway.
25383667 2014 Structural determinants of integrin ?-subunit specificity for latent TGF-?.
25307808 2014 Genetic association for caries susceptibility among cleft lip and/or palate individuals.
25257729 2014 Wild-type p53 inhibits pro-invasive properties of TGF-?3 in breast cancer, in part through regulation of EPHB2, a new TGF-? target gene.
24907658 2014 Controlled release of transforming growth factor-?3 from cartilage-extra-cellular-matrix-derived scaffolds to promote chondrogenesis of human-joint-tissue-derived stem cells.
24825427 2014 Liarozole inhibits transforming growth factor-?3--mediated extracellular matrix formation in human three-dimensional leiomyoma cultures.
24635173 Digital imaging analysis to assess scar phenotype.
24438909 2014 The induction of bone formation by the recombinant human transforming growth factor-?3.
24402195 2014 Transforming growth factor (TGF)-? levels and unprovoked recurrent venous thromboembolism.
24306208 2014 Genome-wide transcriptional analysis of differentially expressed genes in diabetic, healing corneal epithelial cells: hyperglycemia-suppressed TGF?3 expression contributes to the delay of epithelial wound healing in diabetic corneas.
24056369 2013 Transforming growth factor-?3 (TGF-?3) knock-in ameliorates inflammation due to TGF-?1 deficiency while promoting glucose tolerance.
24053560 2013 Transforming growth factor-beta3 gene polymorphisms and nonsyndromic cleft lip and palate risk: a meta-analysis.
23968981 2013 The role of shear-induced transforming growth factor-? signaling in the endothelium.
23824657 2013 A mutation in TGFB3 associated with a syndrome of low muscle mass, growth retardation, distal arthrogryposis and clinical features overlapping with Marfan and Loeys-Dietz syndrome.
23122986 2013 Towards biological anulus repair: TGF-?3, FGF-2 and human serum support matrix formation by human anulus fibrosus cells.
23023602 2012 Transforming growth factor-?3 intron 5 polymorphism as a screening marker for non-syndromic cleft lip with or without cleft palate.
22880017 2012 Serotonin potentiates transforming growth factor-beta3 induced biomechanical remodeling in avian embryonic atrioventricular valves.
22796605 2012 Interleukin-1 beta and transforming growth factor-beta 3 cooperate to activate matrix metalloproteinase expression and invasiveness in A549 lung adenocarcinoma cells.
22795539 2012 SOX9 gene plus heparinized TGF-? 3 coated dexamethasone loaded PLGA microspheres for inducement of chondrogenesis of hMSCs.
22706080 2012 TGF-? mediates proinflammatory seminal fluid signaling in human cervical epithelial cells.
22674391 2012 Role of integrin switch and transforming growth factor Beta 3 in hypoxia-induced invasion inhibition of human extravillous trophoblast cells.
22464821 2012 Posttraumatic temporal TGF-? mRNA expression in lens epithelial cells of paediatric patients.
22409215 2012 Genetic and environmental risk factors for submucous cleft palate.
22369552 2012 Modulation of epithelial tight junctions by TGF-beta 3 in cultured oral epithelial cells.
22266274 2012 The involvement of inflammatory cytokines in the pathogenesis of recurrent miscarriage.
22191848 2012 TGFB3 and BMP4 polymorphism are associated with isolated tooth agenesis.
22143699 2012 Evidence for transforming growth factor-beta 3 gene polymorphism in non-syndromic cleft lip and palate patients from Indian sub-continent.
21823016 2011 Construction of eukaryotic expression plasmid of hTGF-?3 and its inducing effect on differentiation of precartilaginous stem cells into chondroblasts.
21666950 2011 Growth medium with low serum and transforming growth factor beta 3 promotes better chondrogenesis of bone marrow-derived stem cells in vitro and in vivo.
21611961 2011 Biphasic effects of transforming growth factor ? on bone morphogenetic protein-induced osteoblast differentiation.
21423151 2011 TGF-? signalling is mediated by two autonomously functioning T?RI:T?RII pairs.
21411746 2011 Linkage of regulators of TGF-? activity in the fetal ovary to polycystic ovary syndrome.
21352603 2011 Downregulation of TGF-beta receptor types II and III in oral squamous cell carcinoma and oral carcinoma-associated fibroblasts.
21305699 2012 Effects of transforming growth factor-? subtypes on in vitro cartilage production and mineralization of human bone marrow stromal-derived mesenchymal stem cells.
21177256 2011 MSX1 and TGF-beta3 are novel target genes functionally regulated by FOXE1.
21084396 2011 Leiomyoma simultaneously impair endometrial BMP-2-mediated decidualization and anticoagulant expression through secretion of TGF-?3.
21041550 2011 The identification of a novel locus for mandibular prognathism in the Han Chinese population.
20945347 2011 Mechanisms of transforming growth factor ? induced cell cycle arrest in palate development.
20875417 2011 TGF-?2 suppresses macrophage cytokine production and mucosal inflammatory responses in the developing intestine.
20736064 2010 Synthesis of embryonic tendon-like tissue by human marrow stromal/mesenchymal stem cells requires a three-dimensional environment and transforming growth factor ?3.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20613589 2010 Elucidating mechanisms of osteogenesis in human adipose-derived stromal cells via microarray analysis.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20497023 2010 Overexpression of transforming growth factor (TGF)-beta1 and TGF-beta3 genes in lung of toxic-inhaled patients.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20408761 2010 Transforming growth factor beta-3 and environmental factors and cleft lip with/without cleft palate.
20407224 2010 Hypertrophy in mesenchymal stem cell chondrogenesis: effect of TGF-beta isoforms and chondrogenic conditioning.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237132 2010 Regulation of the matricellular proteins CYR61 (CCN1) and NOV (CCN3) by hypoxia-inducible factor-1{alpha} and transforming-growth factor-{beta}3 in the human trophoblast.
20170386 2010 Association between TGFB3 and nonsyndromic cleft lip with or without cleft palate in a Chilean population.
20142847 2010 Differential expression of transforming growth factor-beta isoforms in bullous keratopathy corneas.
20083094 2010 The association between transforming growth factor beta3 polymorphisms and left ventricular structure in hypertensive subjects.
20082468 2010 MTHFR, TGFB3, and TGFA polymorphisms and their association with the risk of non-syndromic cleft lip and cleft palate in China.
19937272 2010 Expression of TGF-beta signaling factors in invasive breast cancers: relationships with age at diagnosis and tumor characteristics.
19897194 2010 Assessment of the association between genetic polymorphisms in transforming growth factor beta, and its binding protein (LTBP), and the presence, and expansion, of Abdominal Aortic Aneurysm.
19787410 2010 TGF-beta3 is expressed in taste buds and inhibits proliferation of primary cultured taste epithelial cells.
19700613 2009 Transforming growth factor beta3 regulates the versican variants in the extracellular matrix-rich uterine leiomyomas.
19656717 2009 TGF-beta3 and cancer: a review.
19651533 2009 Cytokines and junction restructuring events during spermatogenesis in the testis: an emerging concept of regulation.
19628198 2009 Maternal and fetal variants in the TGF-beta3 gene and risk of pregnancy-induced hypertension in a predominantly Latino population.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19432813 2010 Mechanical load modulates chondrogenesis of human mesenchymal stem cells through the TGF-beta pathway.
19396528 2009 Transforming growth factor-(beta)s and mammary gland involution; functional roles and implications for cancer progression.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19328471 2010 Myometrial cells undergo fibrotic transformation under the influence of transforming growth factor beta-3.
19231643 2009 Up-regulation of transforming growth factor-beta3 and extracellular matrix proteins in acquired reactive perforating collagenosis.
19212830 2009 Expression of decorin in esophageal cancer in relation to the expression of three isoforms of transforming growth factor-beta (TGF-beta1, -beta2, and -beta3) and matrix metalloproteinase-2 activity.
19161338 2009 TbetaR-II discriminates the high- and low-affinity TGF-beta isoforms via two hydrogen-bonded ion pairs.
19107876 2009 TGFbeta3 and loading increases osteocyte survival in human cancellous bone cultured ex vivo.
19062040 2009 Studies of TGF-beta(1-3) in serosal fluid during abdominal surgery and their effect on in vitro human mesothelial cell proliferation.
18950289 2009 BMP-2 enhances TGF-beta3-mediated chondrogenic differentiation of human bone marrow multipotent mesenchymal stromal cells in alginate bead culture.
18799618 2008 Snail and Slug promote epithelial-mesenchymal transition through beta-catenin-T-cell factor-4-dependent expression of transforming growth factor-beta3.
18718461 2008 Signaling via the Tgf-beta type I receptor Alk5 in heart development.
18698632 2008 Genetic susceptibilities in the association between maternal exposure to tobacco smoke and the risk of nonsyndromic oral cleft.
18505915 2008 Transforming growth factor-beta1, transforming growth factor-beta2, and transforming growth factor-beta3 enhance ovarian cancer metastatic potential by inducing a Smad3-dependent epithelial-to-mesenchymal transition.
18498721 2008 Quantitative analysis of transforming growth factor beta isoforms mRNA in the human corneal epithelium.
18480962 2008 TGFB3 displays parent-of-origin effects among central Europeans with nonsyndromic cleft lip and palate.
18293167 2008 Association between genetic variation in transforming growth factors beta1 and beta3 and renal dysfunction in non-diabetic Chinese.
18243111 2008 Cooperative assembly of TGF-beta superfamily signaling complexes is mediated by two disparate mechanisms and distinct modes of receptor binding.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18156205 2008 Severe intrauterine growth restriction pregnancies have increased placental endoglin levels: hypoxic regulation via transforming growth factor-beta 3.
18080134 2008 Developing human minor salivary glands: morphological parallel relation between the expression of TGF-beta isoforms and cytoskeletal markers of glandular maturation.
18078367 Expression of transforming growth factor-beta 1, -beta 2, and -beta 3 in human developing teeth: immunolocalization according to the odontogenesis phases.
18049952 2007 Disease-related quantitation of TGF-beta3 in human aqueous humor.
18039789 2008 Opposite regulation of transforming growth factors-beta2 and -beta3 expression in the human endometrium.
17827158 2007 Mechanisms for asporin function and regulation in articular cartilage.
17673689 2008 Collagen I promotes epithelial-to-mesenchymal transition in lung cancer cells via transforming growth factor-beta signaling.
17671384 2008 Placental overexpression of transforming growth factor-beta3 in the HELLP syndrome.
17401695 2007 Bone formation zones in heterotopic ossifications: histologic findings and increased expression of bone morphogenetic protein 2 and transforming growth factors beta2 and beta3.
17272867 2007 Few associations of candidate genes with nonsyndromic orofacial clefts in the population of Lithuania.
17225872 Retinoic acid, GABA-ergic, and TGF-beta signaling systems are involved in human cleft palate fibroblast phenotype.
16930538 2006 Regulation of E-cadherin and TGF-beta3 expression by CD24 in cultured oral epithelial cells.
16781676 2006 Hunchback sequence binding protein suppresses mouse TGF-beta3 promoter in vitro.
16778279 2006 Transforming growth factor-beta gene polymorphisms in sarcoidosis patients with and without fibrosis.
16549496 2006 A "traffic control" role for TGFbeta3: orchestrating dermal and epidermal cell motility during wound healing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16247549 2006 PAX9 and TGFB3 are linked to susceptibility to nonsyndromic cleft lip with or without cleft palate in the Japanese: population-based and family-based candidate gene analyses.
16210002 2005 Regulation of proliferation, motility, and contractivity of cultured human endometrial stromal cells by transforming growth factor-beta isoforms.
16043141 2005 Genetic susceptibility to keloid disease: mutation screening of the TGFbeta3 gene.
15924806 2005 [No association between 3 polymorphisms of transforming growth factor beta3 gene and essential hypertension in Chinese].
15896309 2005 Transforming growth factor-beta2 enhances differentiation of cardiac myocytes from embryonic stem cells.
15639475 2005 Regulatory mutations in transforming growth factor-beta3 gene cause arrhythmogenic right ventricular cardiomyopathy type 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247411 2004 Vasorin, a transforming growth factor beta-binding protein expressed in vascular smooth muscle cells, modulates the arterial response to injury in vivo.
15155569 2004 Hypoxia-inducible factor-1 transactivates transforming growth factor-beta3 in trophoblast.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15017149 2004 Sequential resonance assignments of the extracellular domain of the human TGFbeta type II receptor in complex with monomeric TGFbeta3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679171 2003 Epithelial-mesenchymal transition and its implications for fibrosis.
14659070 2003 Transforming growth factor-beta3 gene SfaN1 polymorphism in Korean nonsyndromic cleft lip and palate patients.
12911534 2003 TGF-beta isoforms in renal fibrogenesis.
12772773 2003 Glucocorticoids modulate TGF-beta production by human fetal lung fibroblasts.
12733956 2003 Genetic association studies of cleft lip and/or palate with hypodontia outside the cleft region.
12729750 2003 Transforming growth factor-beta (TGF-beta) binding to the extracellular domain of the type II TGF-beta receptor: receptor capture on a biosensor surface using a new coiled-coil capture system demonstrates that avidity contributes significantly to high affinity binding.
12652527 2003 Variants of developmental genes (TGFA, TGFB3, and MSX1) and their associations with orofacial clefts: a case-parent triad analysis.
12651933 2003 MSX1 and TGFB3 contribute to clefting in South America.
12607775 2002 Transforming growth factors beta1, beta2 and beta3 and their receptors are differentially expressed in human peritoneal fibroblasts in response to hypoxia.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12489185 2002 TGF-beta latency-associated peptides (LAPs) in human dentin matrix and pulp.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432546 2002 Interference with TGF-beta1 and -beta3 in tumor stroma lowers tumor interstitial fluid pressure independently of growth in experimental carcinoma.
12410804 2002 Transforming growth factor-beta (TGF-beta) and tissue transglutaminase expression in the small intestine in children with coeliac disease.
12358597 2003 The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.
12221089 2002 Dynamics-modulated biological activity of transforming growth factor beta3.
12171249 2002 Regulation of colony-stimulating factor-induced human myelopoiesis by transforming growth factor-beta isoforms.
12168782 2002 Regulation of human endometrial transforming growth factor beta1 and beta3 isoforms through menstrual cycle and medroxyprogesterone acetate treatment.
12062452 2002 Latent TGF-beta binding protein-3 (LTBP-3) requires binding to TGF-beta for secretion.
12060054 2002 Transforming growth factor-beta 1, 2, 3 and receptor type I and II in diabetic foot ulcers.
12021923 2002 Transforming growth factor-beta isoform and receptor expression in chondrosarcoma of bone.
11969342 2002 TGF-beta 3 expression during umbilical cord development and its alteration in pre-eclampsia.
11850637 2002 Crystal structure of the human TbetaR2 ectodomain--TGF-beta3 complex.
11821050 2002 The integrin alphaVbeta6 binds and activates latent TGFbeta3.
11776328 2001 Differential mechanisms of plasminogen activator inhibitor-1 gene activation by transforming growth factor-beta and tumor necrosis factor-alpha in endothelial cells.
11754469 2002 Testing candidate genes for non-syndromic oral clefts using a case-parent trio design.
11488419 2001 Immunohistochemical localization of members of the transforming growth factor (TGF)-beta superfamily in normal human salivary glands and pleomorphic adenomas.
11384957 2001 Evaluation of two putative susceptibility loci for oral clefts in the Danish population.
11382746 2001 Real-time monitoring of the interactions of transforming growth factor-beta (TGF-beta ) isoforms with latency-associated protein and the ectodomains of the TGF-beta type II and III receptors reveals different kinetic models and stoichiometries of binding.
11374028 2001 Transforming growth factor-betas and CD105 expression in calcification and bone formation in human atherosclerotic lesions.
11341298 2001 Analysis of TGFbeta3 gene expression and protein levels in human bone and serum.
11199370 2000 In situ expression of transforming growth factor-beta1-3, latent transforming growth factor-beta binding protein and tumor necrosis factor-alpha in liver tissue from patients with chronic hepatitis C.
11166150 2001 Differential expression of transforming growth factors-beta1, -beta2 and -beta3 in human colon carcinoma.
11158066 2001 Human leiomyoma smooth muscle cells show increased expression of transforming growth factor-beta 3 (TGF beta 3) and altered responses to the antiproliferative effects of TGF beta.
11157754 2001 Type III TGF-beta receptor-independent signalling of TGF-beta2 via TbetaRII-B, an alternatively spliced TGF-beta type II receptor.
10930463 2000 Specific sequence motif of 8-Cys repeats of TGF-beta binding proteins, LTBPs, creates a hydrophobic interaction surface for binding of small latent TGF-beta.
10457363 1999 Role and interaction of connective tissue growth factor with transforming growth factor-beta in persistent fibrosis: A mouse fibrosis model.
10187774 1999 Assignment of transforming growth factor beta1 and beta3 and a third new ligand to the type I receptor ALK-1.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9683588 1998 Association of MSX1 and TGFB3 with nonsyndromic clefting in humans.
9250163 1997 Transforming growth factor-beta, transforming growth factor-beta receptor II, and p27Kip1 expression in nontumorous and neoplastic human pituitaries.
9140123 1997 Transforming growth factor-beta 3 is expressed in nondividing basal epithelial cells in normal human prostate and benign prostatic hyperplasia, and is no longer detectable in prostate carcinoma.
8886879 1996 Cytokine, cell adhesion receptor, and tumor suppressor gene expression in vulvar squamous carcinoma: correlation with prominent fibromyxoid stromal response.
8819159 1996 The crystal structure of TGF-beta 3 and comparison to TGF-beta 2: implications for receptor binding.
8167376 1994 Cloning and developmental expression of the chick type II and type III TGF beta receptors.
8106553 1994 Betaglycan can act as a dual modulator of TGF-beta access to signaling receptors: mapping of ligand binding and GAG attachment sites.
8093006 1994 Interaction of the small interstitial proteoglycans biglycan, decorin and fibromodulin with transforming growth factor beta.
7962292 1994 Human fallopian tube expresses transforming growth factor (TGF beta) isoforms, TGF beta type I-III receptor messenger ribonucleic acid and protein, and contains [125I]TGF beta-binding sites.
7951245 1994 The gene for arrhythmogenic right ventricular cardiomyopathy maps to chromosome 14q23-q24.
7852346 1995 The soluble exoplasmic domain of the type II transforming growth factor (TGF)-beta receptor. A heterogeneously glycosylated protein with high affinity and selectivity for TGF-beta ligands.
7796607 1995 Transforming growth factor-beta 1, -beta 2 and -beta 3 mRNA expression in human cornea.
7493022 1995 Abnormal lung development and cleft palate in mice lacking TGF-beta 3 indicates defects of epithelial-mesenchymal interaction.
3457014 1986 Type beta transforming growth factor in human platelets: release during platelet degranulation and action on vascular smooth muscle cells.
3226728 1988 Chromosomal mapping of genes for transforming growth factors beta 2 and beta 3 in man and mouse: dispersion of TGF-beta gene family.
3208746 1988 A new type of transforming growth factor-beta, TGF-beta 3.
3164476 1988 Identification of another member of the transforming growth factor type beta gene family.
1875922 1991 Inhibition of translation of transforming growth factor-beta 3 mRNA by its 5' untranslated region.
1333888 1992 TGF beta signals through a heteromeric protein kinase receptor complex.
1326540 1992 Endoglin is a component of the transforming growth factor-beta receptor system in human endothelial cells.