Property Summary

NCBI Gene PubMed Count 78
PubMed Score 89.72
PubTator Score 77.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma 2.500 1.6e-06
astrocytoma 1.500 1.6e-14
Astrocytoma, Pilocytic 2.500 1.7e-11
atypical teratoid / rhabdoid tumor 2.500 3.7e-04
Breast cancer -1.600 1.4e-06
breast carcinoma -1.200 1.9e-21
dermatomyositis 1.100 3.0e-02
Duchenne muscular dystrophy 1.165 1.8e-06
ependymoma 1.900 1.0e-07
gastric cancer 1.600 1.3e-03
glioblastoma 2.700 2.2e-11
intraductal papillary-mucinous adenoma (... -2.000 4.6e-04
intraductal papillary-mucinous carcinoma... -1.900 1.8e-03
invasive ductal carcinoma -1.500 1.4e-03
juvenile dermatomyositis 1.086 2.8e-06
lung cancer -1.800 8.4e-04
malignant mesothelioma -1.800 1.3e-06
medulloblastoma 1.100 5.0e-02
oligodendroglioma 1.700 7.8e-12
ovarian cancer -2.200 1.7e-07
pancreatic cancer 1.800 2.4e-04
pancreatic carcinoma 1.800 2.4e-04
pancreatic ductal adenocarcinoma liver m... 1.331 4.3e-02
Pick disease 1.500 1.3e-02
primitive neuroectodermal tumor 1.900 1.6e-03
psoriasis -1.400 1.0e-07
urothelial carcinoma 2.100 4.5e-02

Gene RIF (41)

AA Sequence

MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPK      1 - 70
PAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPS     71 - 140
SPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGL    141 - 210
LQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYF    211 - 280
ERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQ    281 - 350
GPILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL    351 - 420
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG                                 421 - 461
//

Text Mined References (102)

PMID Year Title