Property Summary

NCBI Gene PubMed Count 74
PubMed Score 82.21
PubTator Score 77.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 1.600 1.3e-03
pancreatic cancer 2.100 1.4e-03
urothelial carcinoma 2.100 4.5e-02
malignant mesothelioma -1.800 1.3e-06
psoriasis -1.400 1.0e-07
astrocytoma 1.500 1.6e-14
glioblastoma 3.000 6.3e-07
oligodendroglioma 1.700 7.8e-12
posterior fossa group A ependymoma 2.400 2.5e-13
sonic hedgehog group medulloblastoma 2.300 7.3e-06
atypical teratoid / rhabdoid tumor 2.500 3.7e-04
primitive neuroectodermal tumor 1.900 1.6e-03
Duchenne muscular dystrophy 1.165 1.8e-06
juvenile dermatomyositis 1.086 2.8e-06
primary pancreatic ductal adenocarcinoma 2.080 9.5e-03
intraductal papillary-mucinous adenoma (... -2.000 4.6e-04
intraductal papillary-mucinous carcinoma... -1.900 1.8e-03
lung cancer -1.800 8.4e-04
pediatric high grade glioma 2.800 2.2e-09
pilocytic astrocytoma 2.500 2.6e-11
pancreatic carcinoma 1.800 2.4e-04
breast carcinoma -1.200 1.9e-21
Pick disease 1.500 1.3e-02
Breast cancer -1.600 1.4e-06
invasive ductal carcinoma -1.500 1.4e-03
ovarian cancer -2.200 1.7e-07
dermatomyositis 1.100 3.0e-02

Gene RIF (37)

PMID Text
26416447 Hic-5 plays a central role in the positive feedback ROS-JNK signaling cascade that regulates hepatocellular carcinoma progression.
26313302 Hic-5 siRNA also suppressed TGF-beta2-induced fibrogenic activity and dexamethasone-induced myocilin expression in HTM cells.
25763609 Hic-5 influences the genomic occupancy of multiple steroid receptors and thereby blocks some aspects of hormonal regulation.
25587044 Endothelial Hic-5 plays an important role in the formation of microvilli-like structures and in the interaction between ECs and monocytes, leading to monocyte recruitment and subsequent development of atherosclerosis.
25333259 Studies in vitro and in vivo using TGF-beta1 and TGFB1I1 shRNA demonstrated that TGFB1I1 is required for TGF-beta stimulated EMT that contributes to malignant progression of astrocytomas.
24831009 Hic-5 suppresses senescence and profibrotic activities of myofibroblasts by down-regulating Nox4 expression.
24440747 Hic5 coordinates AR signaling with adhesion and extracellular matrix contacts to regulate cell behavior in the tumor microenvironment.
23145173 The ubiquitin ligase activity of Cbl-c by the direct interaction of the LIM zinc coordinating domain of Hic5 is demonstrated.
23062781 Hic-5 can potentially exercise multiple functions in growth, differentiation, migration and adhesion of keratinocytes, partially via nuclear-cell membrane shuttling.
23007394 the HIC-5- and KLF4-dependent mechanism transactivates p21(Cip1) in response to anchorage loss
22712231 It plays a roll in extracellular matrix remodeling and the signal transduction via reactive oxygen species. (review)
22286178 Findings suggest that hydrogen peroxide-inducible clone-5 (Hic-5) is involved in changes in the mesangial cells (MCs) phenotype to produce abnormal extracellular matrix remodeling in glomerulonephritis (GN).
21996749 these results provide the first evidence for a physical and mutual functional interaction between Hic-5 and the BMP signaling pathway.
21984848 Transforming growth factor-beta1-induced transcript 1 protein, a novel marker for smooth muscle contractile phenotype, is regulated by serum response factor/myocardin protein.
21924870 Androgen receptor transactivity is potentiated by TGF-beta1 through Smad3 but checked by its coactivator Hic-5/ARA55 in balding dermal papilla cells.
21148292 Hic-5 is essential for adhesion formation in 3D extracellular matrices.
20818421 Hic-5/ARA55 expression in response to castration-enabled epithelial regression through the repression of c-myc gene at the chromatin level.
20448481 Hydrogen peroxide-inducible clone 5 is expressed predominantly in pyramidal neurons of human hippocampus.
20395114 Hic-5/ARA55 has roles in keloids through Smad pathway and profibrotic transcription
19389829 The data suggest that the proposed progesterone resistance in endometrium from women with endometriosis derives, in part, from impaired expression of the PR coactivator, Hic-5, in endometrial tissue and cultured endometrial stromal fibroblasts.
18762808 The level of Smad7 is modulated by its physical interaction with Hic-5 and targeted to a degradation pathway not likely to be proteasomal
18401422 Silencing Hic-5 in hypertrophic scar fibroblasts reduces TGF-beta1 production, decreases generation of supermature focal adhesions, reduces expression of smooth-muscle cell alpha-actin and decreases collagen contraction and extracellular matrix synthesis.
17919607 The increased expression of ARA55 is a feature of nonobstructive azoospermia.
17671518 autocrine production of TGF-beta1 upregulates the expression of Hic-5, which is essential for perpetuating the decreased proliferation seen in pathogenic myofibroblast
17508020 Hic-5/ARA55 is a molecular regulator for androgen sensitivity in human hair follicles.
17166536 Review highlights the role that Hic-5 may play in regulating androgen-induced growth factor signaling and/or cytokine expression in the prostate.
16849583 Small interfering RNA ablation experiments established endogenous Hic-5/ARA55 as a coactivator for both viral and endogenous cellular AR-regulated genes.
16624805 human ERK8 has a role as a negative regulator of human GRalpha, acting through Hic-5
16141357 Hic-5/ARA55 is required for optimal GR-mediated gene expression possibly by providing a scaffold that organizes or stabilizes coactivator complexes at some hormone-responsive promoters.
15561701 the C terminus of ARA55 is critical for suppression of Smad3 activity
12858356 Higher ARA55 expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer
12631731 Results show that Hic-5 accumulates in the nucleus in response to oxidants such as hydrogen peroxide
12445807 results suggest that Hic-5 participates in the transcriptional regulation of c-fos as a scaffold in transcriptional complexes.
12400158 a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review
12153727 Results suggest that paxillin and Hic-5 associate with GIT1 with different binding modes.
11937715 that hic-5 plays a role in the initial stage of myogenic differentiation.
11856738 coregulator of androgen receptor coativation, suppresssed by Pyk2

AA Sequence

MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPK      1 - 70
PAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPS     71 - 140
SPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGL    141 - 210
LQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYF    211 - 280
ERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQ    281 - 350
GPILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL    351 - 420
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG                                 421 - 461
//

Text Mined References (98)

PMID Year Title
26416447 2015 Hydrogen peroxide inducible clone-5 mediates reactive oxygen species signaling for hepatocellular carcinoma progression.
26313302 2015 Hic-5 Regulates Actin Cytoskeletal Reorganization and Expression of Fibrogenic Markers and Myocilin in Trabecular Meshwork Cells.
25763609 2015 Selective coregulator function and restriction of steroid receptor chromatin occupancy by Hic-5.
25587044 2015 Role of Hic-5 in the formation of microvilli-like structures and the monocyte-endothelial interaction that accelerates atherosclerosis.
25333259 2014 Multidimensional analysis of gene expression reveals TGFB1I1-induced EMT contributes to malignant progression of astrocytomas.
24831009 2014 Negative regulation of NADPH oxidase 4 by hydrogen peroxide-inducible clone 5 (Hic-5) protein.
24440747 2014 Hic-5 influences genomic and non-genomic actions of the androgen receptor in prostate myofibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145173 2012 Cbl-c ubiquitin ligase activity is increased via the interaction of its RING finger domain with a LIM domain of the paxillin homolog, Hic 5.
23062781 2012 Multipotential functions of Hic-5 in growth, differentiation, migration and adhesion of human keratinocytes.
23007394 2012 A HIC-5- and KLF4-dependent mechanism transactivates p21(Cip1) in response to anchorage loss.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22712231 2012 [Hydrogen peroxide-inducible clone 5 (Hic-5) as a potential therapeutic target].
22286178 2012 Glomerular expression of hydrogen peroxide-inducible clone-5 in human and rat progressive mesangial proliferative glomerulonephritis.
21996749 2012 Hic-5 controls BMP4 responses in prostate cancer cells through interacting with Smads 1, 5 and 8.
21984848 2011 Transforming growth factor-?1-induced transcript 1 protein, a novel marker for smooth muscle contractile phenotype, is regulated by serum response factor/myocardin protein.
21924870 2011 Androgen receptor transactivity is potentiated by TGF-?1 through Smad3 but checked by its coactivator Hic-5/ARA55 in balding dermal papilla cells.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21148292 2011 Distinct roles for paxillin and Hic-5 in regulating breast cancer cell morphology, invasion, and metastasis.
20818421 2011 Epithelial Hic-5/ARA55 expression contributes to prostate tumorigenesis and castrate responsiveness.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20448481 2010 Paxillin and hydrogen peroxide-inducible clone 5 expression and distribution in control and Alzheimer disease hippocampi.
20395114 2010 In vitro and in vivo evidence of pathogenic roles of Hic-5/ARA55 in keloids through Smad pathway and profibrotic transcription.
19855388 2009 Slit2-Robo4 signalling promotes vascular stability by blocking Arf6 activity.
19389829 2009 The progesterone receptor coactivator Hic-5 is involved in the pathophysiology of endometriosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18762808 2008 Smad7 is inactivated through a direct physical interaction with the LIM protein Hic-5/ARA55.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18401422 2008 Hic-5 promotes the hypertrophic scar myofibroblast phenotype by regulating the TGF-beta1 autocrine loop.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17919607 2008 Expression of androgen receptor co-regulators in the testes of men with azoospermia.
17671518 2008 TGF-beta1 slows the growth of pathogenic myofibroblasts through a mechanism requiring the focal adhesion protein, Hic-5.
17508020 2007 Androgen receptor co-activator Hic-5/ARA55 as a molecular regulator of androgen sensitivity in dermal papilla cells of human hair follicles.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17233630 2007 Paxillin family members function as Csk-binding proteins that regulate Lyn activity in human and murine platelets.
17202804 2006 Gonadotropin-releasing hormone functionally antagonizes testosterone activation of the human androgen receptor in prostate cells through focal adhesion complexes involving Hic-5.
17166536 2007 Hic-5/ARA55: a prostate stroma-specific AR coactivator.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16849583 2006 Hic-5/ARA55, a LIM domain-containing nuclear receptor coactivator expressed in prostate stromal cells.
16803896 2006 Serotonin-, protein kinase C-, and Hic-5-associated redistribution of the platelet serotonin transporter.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16624805 2006 ERK8 down-regulates transactivation of the glucocorticoid receptor through Hic-5.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16330715 2005 Subcellular targeting of oxidants during endothelial cell migration.
16141357 2006 Mechanism of action of Hic-5/androgen receptor activator 55, a LIM domain-containing nuclear receptor coactivator.
15687259 2005 Hic-5 regulates an epithelial program mediated by PPARgamma.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15561701 2005 Novel function of androgen receptor-associated protein 55/Hic-5 as a negative regulator of Smad3 signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15211577 2004 Distinct LIM domains of Hic-5/ARA55 are required for nuclear matrix targeting and glucocorticoid receptor binding and coactivation.
14755691 2004 A LIM protein, Hic-5, functions as a potential coactivator for Sp1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12858356 2003 Expression of AR associated protein 55 (ARA55) and androgen receptor in prostate cancer.
12772188 2003 Expression of androgen receptor coactivators in normal and cancer prostate tissues and cultured cell lines.
12714604 2003 The use of phage display technique for the isolation of androgen receptor interacting peptides with (F/W)XXL(F/W) and FXXLY new signature motifs.
12700349 2003 Inactivation of androgen receptor coregulator ARA55 inhibits androgen receptor activity and agonist effect of antiandrogens in prostate cancer cells.
12642630 2003 Expression of the LIM proteins paxillin and Hic-5 in human tissues.
12631731 2003 Hic-5 communicates between focal adhesions and the nucleus through oxidant-sensitive nuclear export signal.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445807 2002 Transcriptional activation of the c-fos gene by a LIM protein, Hic-5.
12426580 2002 BMP4 initiates human embryonic stem cell differentiation to trophoblast.
12421567 2002 Co-evolutionary analysis reveals insights into protein-protein interactions.
12417722 2002 Rapamycin potentiates transforming growth factor beta-induced growth arrest in nontransformed, oncogene-transformed, and human cancer cells.
12400158 2002 [Regulation of gene expression by active oxygen species].
12376363 2002 TGF-beta1 stimulates HO-1 via the p38 mitogen-activated protein kinase in A549 pulmonary epithelial cells.
12202987 2002 A catalog of 106 single-nucleotide polymorphisms (SNPs) and 11 other types of variations in genes for transforming growth factor-beta1 (TGF-beta1) and its signaling pathway.
12177201 2002 The multiple LIM domain-containing adaptor protein Hic-5 synaptically colocalizes and interacts with the dopamine transporter.
12153727 2002 Hic-5 interacts with GIT1 with a different binding mode from paxillin.
12023963 2002 Involvement of TRAF4 in oxidative activation of c-Jun N-terminal kinase.
11937715 2002 Possible involvement of hic-5, a focal adhesion protein, in the differentiation of C2C12 myoblasts.
11856738 2002 Suppression of androgen receptor transactivation by Pyk2 via interaction and phosphorylation of the ARA55 coregulator.
11805099 2002 Syndesmos, a syndecan-4 cytoplasmic domain interactor, binds to the focal adhesion adaptor proteins paxillin and Hic-5.
11792840 2002 Supervillin associates with androgen receptor and modulates its transcriptional activity.
11546764 2001 Identification and characterization of hic-5/ARA55 as an hsp27 binding protein.
11532379 2001 Potential anti-androgenic activity of roxithromycin in skin.
11489729 2001 Different expression of androgen receptor coactivators in human prostate.
11463817 2001 Hic-5-reduced cell spreading on fibronectin: competitive effects between paxillin and Hic-5 through interaction with focal adhesion kinase.
11313252 2001 CrkL is an adapter for Wiskott-Aldrich syndrome protein and Syk.
11311131 2001 Involvement of Hic-5 in platelet activation: integrin alphaIIbbeta3-dependent tyrosine phosphorylation and association with proline-rich tyrosine kinase 2.
11155740 2000 Functional analysis of androgen receptor N-terminal and ligand binding domain interacting coregulators in prostate cancer.
10848625 2000 Interaction of the tau2 transcriptional activation domain of glucocorticoid receptor with a novel steroid receptor coactivator, Hic-5, which localizes to both focal adhesions and the nuclear matrix.
10838081 2000 Phosphorylation of Hic-5 at tyrosine 60 by CAKbeta and Fyn.
10708479 2000 Molecular cloning of human Hic-5, a potential regulator involved in signal transduction and cellular senescence.
10604475 1999 Binding of paxillin to alpha4 integrins modifies integrin-dependent biological responses.
10330411 1999 Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling.
10092676 1999 Hic-5, a paxillin homologue, binds to the protein-tyrosine phosphatase PEST (PTP-PEST) through its LIM 3 domain.
10075738 1999 Cloning and characterization of androgen receptor coactivator, ARA55, in human prostate.
9858471 1999 Characterization of a focal adhesion protein, Hic-5, that shares extensive homology with paxillin.
9756887 1998 Interaction of Hic-5, A senescence-related protein, with focal adhesion kinase.
9664039 1998 Recruitment of the LIM protein hic-5 to focal contacts of human platelets.
9422762 1998 Cell adhesion kinase beta forms a complex with a new member, Hic-5, of proteins localized at focal adhesions.
9032249 1997 Induction of senescence-like phenotypes by forced expression of hic-5, which encodes a novel LIM motif protein, in immortalized human fibroblasts.
7929412 1994 Characterization of the TGF beta 1-inducible hic-5 gene that encodes a putative novel zinc finger protein and its possible involvement in cellular senescence.
1716619 1991 Epidermal growth factor and its receptor, basic fibroblast growth factor, transforming growth factor beta-1, and interleukin-1 alpha messenger RNA production in human corneal endothelial cells.