Property Summary

NCBI Gene PubMed Count 209
PubMed Score 135.26
PubTator Score 1055.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cleft Lip 141 5.267 2.6
Cleft Palate 265 4.993 2.5
Cancer 2388 3.226 1.6
Disease Target Count
Tooth agenesis 42

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.400 1.7e-09
astrocytic glioma -1.700 2.2e-02
Astrocytoma, Pilocytic 2.100 1.3e-04
Breast cancer -1.800 9.0e-06
Down syndrome 1.100 1.3e-03
ependymoma -1.900 2.8e-02
group 3 medulloblastoma -2.200 1.4e-03
interstitial cystitis -1.200 4.9e-03
intraductal papillary-mucinous adenoma (... 1.200 8.5e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.0e-02
lung cancer 1.800 7.9e-03
nephrosclerosis -1.154 1.9e-02
non-small cell lung cancer 1.540 5.2e-13
osteosarcoma 2.224 1.4e-09
ovarian cancer 1.400 4.7e-03
pancreatic cancer 1.100 2.1e-02
pancreatic carcinoma 1.100 2.1e-02
spina bifida -2.165 3.9e-02
subependymal giant cell astrocytoma -1.816 2.0e-02
tuberculosis -1.700 1.7e-05
ulcerative colitis -1.200 5.0e-04

Gene RIF (158)

AA Sequence

MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPA      1 - 70
CVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRH     71 - 140
EKPSALLKGRTACCHSETVV                                                      141 - 160
//

Text Mined References (213)

PMID Year Title