Property Summary

NCBI Gene PubMed Count 159
PubMed Score 7391.95
PubTator Score 2484.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.400 2.5e-06
posterior fossa group B ependymoma 1.200 8.1e-06
psoriasis -2.000 1.3e-73

Gene RIF (122)

PMID Text
26963610 +49A/G and CT60 polymorphism of CTLA4 and E33 polymorphism of TG may be genetic risk factors for autoimmune hypothyroidism susceptibility.
26896794 The system is characterized by a very high sensitivity and specificity allowing the ex-vivo detection of sub ng/ml concentrations of human Thyroglobulin from needle washouts of fine-needle aspiration biopsies of thyroid nodule from different patients.
26777470 22 rare non-polymorphic variants including six truncating variants and 16 missense variants of unknown significance in Chinese patients with congenital hypothyroidism.
26595189 Data suggest that primary functions of TG include iodide storage and thyroid hormonogenesis; combinations of nonsense mutations, frameshift mutations, splice site mutations, and missense mutations in TG occur spontaneously to cause congenital hypothyroidism and thyroidal endoplasmic reticulum stress. [REVIEW]
26099577 Tg SNP haplotypes are associated with hypothyroidism, hyperthyroidism and Hashimoto's disease.
25895485 A prominent transient early increase in thyroglobulin levels was found in thyroid cancer patients post-radioiodine ablation.
25893415 High Thyroglobulin Levels are associated with recurrence in Thyroid Carcinoma.
25633667 Results from a Vietnamese family with goiter and hypothyroidism identified 2 novel mutations in thyroglobulin gene resulting in the abolition of the authentic splice donor sites.
25607926 In the diagnosis of lymphatic metastasis in papillary thyroid carcinoma, FNA-Tg levels in the preoperative state are affected by serum Tg levels when they exceeded 1.0 mug/L.
25536321 The mean and median of thyroglobulin were calculated in these subgroups. Tg concentrations were dependent on gender/
25213012 High serum thyroglobulin concentration is associated with malignancy in small follicular and Hurthle cell neoplasms of the thyroid gland.
24762031 Thyroglobulin may be a biomarker of iodine deficiency [review]
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.
24565964 We analyzed the influence of postmortem changes on Tg concentration. Tg concentration can increase above the standard value and that a difference between the Tg concentration of RHB and LHB arises as a result of postmortem changes.
24460082 Data suggest serum TG level (low but measurable following stimulation with recombinant thyroid stimulating hormone or withdrawal of thyroid hormone) is predictive of incomplete response to surgery/radioiodine therapy in differentiated thyroid cancer.
24341425 Data suggest that serum thyroglobulin levels are up-regulated in patients with well-differentiated thyroid cancers as compared to patients with benign thyroid nodules.
24064687 Iodine-induced thyroid autoimmunity is related to TgAb and the unmasking of a cryptic epitope on Tg contributes to this relationship in humans.
24057177 Regions in the Hsp60 molecule show structural similarity with the thyroglobulin (TG) and thyroid peroxidase (TPO) molecules supporting the notion that autoantibodies against TG and TPO are likely to recognize Hsp60 on the plasma membrane of oncocytes.
23949896 Novel truncating thyroglobulin gene mutations are associated with congenital hypothyroidism.
23933148 A novel large imperfect DNA inversion within the TG gene causes hereditary hypothyroidism.
23900865 The combined TG and CK19 quantitative real-time PCR could be used to select a previously missed group of patients with nodal involvement of Papillary thyroid cancer
23886742 Applying the optimized cutoff value of washout thyroglobulin of 1.8 ng/mL in patients with suspicious ultrasonographic features facilitates the diagnostic evaluation of neck lymph nodes.
23826916 Data indicate that thyroglobulin (Tg) is a good predictor of remission of disease at 18-24 months after initial treatment and could be a useful marker to stratify risk immediately after surgery.
23489940 Postoperative-stimulated Tg at the time of (131)I remnant ablation is a useful biochemical marker for prediction of disease status in patients with differentiated thyroid carcinoma after total thyroidectomy.
23455760 A novel point mutation in a thyroglobulin stop codon at position 768 causing congenital hypothyroidism was found in a man and his two daughters.
23360821 Glycosylation of sera thyroglobulin antibody was varied in different thyroid diseases.
23345097 In school-aged children, Tg is a sensitive indicator of both low and excess iodine intake.
23242039 Ablation-Tg levels of 50 mug/L or greater are a valuable initial predictor of disease persistence/recurrence in high-risk differentiated thyroid cancer patients.
23190420 Data indicate that in residents of Belarus, serum thyroglobulin (Tg) is significantly related to presence of thyroid abnormalities.
23164529 Characterization of goiter and hypothyroidism phenotypes associated with inactivating mutations in the thyroglobulin gene.
22784463 compound heterozygous mutation in the TG gene in a Chinese twin family with congenital goiter and hypothyroidism; study provides further evidence that TG mutations cause congenital goiter and hypothyroidism, demonstrates genetic heterogeneity of the mutation and increases understanding of phenotype-genotype correlations
22662162 the thyroglobulin gene is involved in susceptibility for Graves' disease (GD) and Hashimoto's thyroiditis in the Japanese.
22517745 Findings suggest that thyroglobulin (Tg) and thyroid-stimulating hormone receptor (TSHR) detected in orbital connective tissues in thyroid-associated ophthalmopathy (TAO) result from local fibrocyte biosynthetic activity.
22265031 Epistasis between the HSD17B4 and thyroglobulin polymorphisms is associated with premature ovarian failure.
22259066 Data suggest that in Hashimoto's thyroiditis, both antigens, TG and thyroperoxidase, are recognized by peripheral and thyroid gland infiltrating CD8-positive T-cells and are involved in thyroid destruction leading to clinical disease manifestation.
22170797 Cold exposure influences thyroid hormones and TG activity in serum in Arctic populations consistent with consumption of thyroid hormone and higher thyroid hormone turnover.
22136267 In differentiated thyroid cancer, an incomplete structural response to therapy is associated with significantly worse clinical outcomes than only an incomplete thyroglobulin response.
22136265 Papillary thyroid carcinoma patients assessed to be at low or intermediary risk after primary treatment are at greater risk of long term recurrence if they are thyroglobulin antibody positive or do not have low thyroglobulin at initial assessment.
22098450 minimal Tg T-cell epitopes, defined as autoantigenic in hosts of various MHC haplotypes, are not intrinsically immunogenic
21958696 the g.IVS19+3_+4delAT mutation promotes the activation of a cryptic donor splice site in the exon 19 of the thyroglobulin gene
21757724 mechanism of interaction between environmental (IFNalpha) and genetic (TG) factors to trigger autoimmune thyroid diseases
21646855 In patients with well-differentiated thyroid cancer, a post-thyroidectomy thyroglobulin level less than 10 ng/ml is associated with a low probability of having persistent disease.
21636579 Mutations causing hypothyroidism might induce solely local/regional misfolding or may interfere more globally by impeding interactions between regions that are required for thyroglobulin secretion
21476894 common variants of the thyroglobulin gene are associated with differentiated thyroid cancer risk
21372558 Thyroglobulin gene mutations in congenital hypothyroidism.
21039721 Patients with detectable Tg during the last (1)(3)(1)I treatment and a negative post-therapeutic WBS have significant earlier and more recurrences than patients without detectable Tg.
20972728 Molecular findings in Argentinean patients with goitrous congenital hypothyroidism.
20972722 Association between the thyroglobulin gene and autoimmune thyroiditis in Argentinian population.
20972722 Observational study of gene-disease association. (HuGE Navigator)
20960158 Results suggest that TG is a susceptibility gene for AT and confirm previous reports that associated polymorphisms within the TG gene and autoimmune thyroiditis.
20960158 Observational study of gene-disease association. (HuGE Navigator)
20864102 Variants of the thyroglobulin gene were significantly associated with premature ovarian failure in a Korean population
20864102 Observational study of gene-disease association. (HuGE Navigator)
20573721 Findings demonstrate a novel aspect of murine and human thyroid autoimmunity, namely breaking B cell self-tolerance occurs first for Tg and subsequently for TPO.
20486066 Heterophile antibody interference is not a factor to be reckoned with in the daily practice of Tg measurement.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20353937 specific properties of distinct Tg ChEL mutants may result in distinct patterns of Tg monomer folding
20215770 Observational study of gene-disease association. (HuGE Navigator)
20182447 Epitopic cross-reactivity does not explain the increased prevalence of Hashimoto thyroiditis found in chronic idiopathic urticaria patients
20173019 This new mRNA Tg quantification is a reliable method that allowed us to differentiate thyroid carcinoma patients free of disease from those with metastases
20089614 Biallelic c.6725G>A (p.R2223H) mutation causes thyroglobulin retention in the endoplasmic reticulum, resulting in dyshormonogenesis.
19837936 TG defects have an important role in severe thyroidal dyshormonogenesis
19776016 interactions between Tg and discrete HLA-DR pocket signatures contribute to the initiation of autoimmune thyroid disease
19730683 Observational study of gene-disease association. (HuGE Navigator)
19633549 Mutations of the thyroglobulin gene and its relevance to thyroid disorders.
19509106 The p.A2215D thyroglobulin gene mutation leads to deficient synthesis and secretion of the mutated protein and congenital hypothyroidism with wide phenotype variation.
19438905 A novel nonsense mutation p.R2317X in the acetylcholinesterase homology domain of TG.
19438904 The preliminary results demonstrate that the immune-regulatory gene CTLA-4 and the thyroid-specific gene Tg contribute to the risk of Graves' disease with additive effects.
19416000 Case Report: Identification of a neck lump as a lymph node metastasis from an occult contralateral papillary microcarcinoma of the thyroid- key role of thyroglobulin assay in the fine-needle aspirate.
19404338 Results of our study suggest that thyroglobulin is an autoantigen that is recognized by thyroid MALT lymphoma cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19194833 The population living in two areas was exposed to consequences of severe and moderate iodine deficiency
19034705 existence of four single nucleotide polymorphisms among Han Chinese, one SNP haplotype with Hashimoto thyroiditis suggests that TG may be a susceptibility gene
19034705 Observational study of gene-disease association. (HuGE Navigator)
18755875 the frequencies of genotypes in the TG gene E10, E12, and E33 SNPs were not found to be significantly different in Grave disease patients who developed GD when aged over 40 years when compared with those aged below 40 years
18755875 Observational study of gene-disease association. (HuGE Navigator)
18656705 analysis of family data did not show linkage of the thyroglobulin gene with autoimmune thyroid diseases nor did analysis of case-control data show association of Tgms2 or SNPs with Graves' disease
18636294 Elevated thyroglobulin levels post surgery are associated with disease recurrence in papillary thyroid carcinoma
18631008 There is an association of the IVS30+G>T mutation of the thyroglobulin gene with hypothyroidism.
18566446 peptides from autoantigens are also associated to HLA-DR in vivo and therefore may well be involved in the maintenance and the regulation of the autoimmune response
18514160 Observational study of gene-disease association. (HuGE Navigator)
18385936 three single nucleotide polymorphisms were identified within the Tg gene
18385936 Observational study of gene-disease association. (HuGE Navigator)
18271683 connection between infection of H. pylori and the occurrence of anti-TPO autoantibodies representing thyroid autoimmunity and gastric parietal cells autoantibodies representing the thyrogastric syndrome
18243140 levels of thyroglobulin (Tg) mRNA in the TSH-stimulated lymphocytes were noticeably increased in subjects with thyroid disease suggesting an interesting relationship between production of Tg antigen in peripheral blood and autoimmunity in thyroid disease
18166820 Tg and TgAb negativity at the time of ablation is not a predictive determinant for future recurrent status.
17911408 analysis of the recurrence of the p.R277X/p.R1511X compound heterozygous mutation in the TG gene in two unrelated families (one Argentinian and another Brazilian) with congenital hypothyroidism, goiter and impairment of TG synthesis
17902201 There is no systematic variation during the menstrual cycle in autoantibodies against thyroid peroxidase, thyroglobulin, and thyrotropin receptor
17854396 Papillary thyroid cancers Papillary thyroid cancers with no 131I uptake had slightly reduced NIS, significantly reduced thyroglobulin,thyroperoxidase and pendrin and significantly increased GLUT-1 gene expression levels.
17671725 expression level of thyroglobulin mRNA in the anaplastic thyroid carcinoma tissue and cell lines was <10(2) times higher than that in the differentiated thyroid carcinomas.
17644307 We have identified the thyroglobulin gene in females with autoimmune thyroid diseases.
17550957 Observational study of gene-disease association. (HuGE Navigator)
17550957 study showed Taiwanese patients with the C/C genotype of E33SNP, smoking, ophthalmopathy & positive TSH-receptor antibodies at the end of the treatment were more likely to have a relapse of Graves' hyperthyroidism after antithyroid medication is withdrawn
17532758 We report three patients with congenital hypothyroidism with goitre caused by two compound heterozygous mutations, p.C164Y/p.L234fsX237 and p.R277X/p.A2215D, and one homozygous mutation, p.R277X, in the TG gene.
17526951 Observational study of gene-disease association. (HuGE Navigator)
17526951 TT (exon 33) genotype frequency in Graves disease patients significantly higher than the controls
17278897 Combined use of serum Tg levels measured just before before thyroid cancer thyroidecatomy an indicator of success, when combined wiwth I131 treaatment.
17244789 Increased diodinase activity in the thyroid gland is responsible for the higher serum-free levels in patients with defective thyroglobin transport.
16679516 molecular mechanism of regulation of the hormonogenic efficiency and of the T4/T3 ratio in hTg
16646680 Observational study of gene-disease association. (HuGE Navigator)
16646680 results may suggest interaction between the DRbeta1 chain R genotype & thyroglobulin CC genotype in conferring susceptibility to Graves disease; these results, if confirmed, may imply that these variants interact biologically to increase the odds of GD
16477365 A heterozygous mutation in TG resulted in congenital goitrous hypothyroidism with high serum triiodothyronine levels.
16403815 Aberrant splicing occurs as a result of a mutation, which causes fusion of exons 4 and 6, resulting in the frame shift at codon position 141 and a premature stop codon at position 147.
16271015 The alternative splicing of the TG gene described in this article constitutes a new case of nonsense-associated alternative splicing.
16260629 pendrin and thyroglobulin are downstream targets in vivo of TTF-1, whose action is a prime factor in controlling thyroid differentiation in vivo
16230285 Thyroglobulin assays are immunoassays that may be hampered by autoantibodies directed against Tg. To avoid this problem some authors advocated the use of mRNA extraction and RT-PCR amplification.
15785246 Clinical value of a differential response of thyroglobulin (Tg) concentration after recombinant human thyrotropin in thyroid paxpillary adenocarcinoma after thyroidectomy.
15769978 a new case of congenital goiter and hypothyroidism caused by a p.R277X mutation in the TG gene
15579800 Observational study of gene-disease association. (HuGE Navigator)
15579800 At this stage, we cannot exclude the Tg region as harboring a susceptibility locus for autoimmune thyroid disease.
15579752 Location and volume of metastases influence basal Tg, but not its responsiveness to rhTSH, whereas the histological type of carcinoma influences both basal Tg and responsiveness to rhTSH.
15562032 Hypothyroidism during type I interferon therapy may be related to an abnormal expression and function of key proteins involved in iodine uptake and organification.
15272924 Observational study of gene-disease association. (HuGE Navigator)
15070908 The rise in Tg with TSH and the reduction in Tg with L-T(4) provide evidence of target tissue response to TSH and further confirm the TSH rise as physiologically significant.
14764582 the native structure of the AChE region of thyroglobulin functions as a dimerization domain facilitating intracellular transport of Tg to the site of thyroid hormonogenesis
14633662 Observational study of gene-disease association. (HuGE Navigator)
14557492 Observational study of gene-disease association. (HuGE Navigator)
14557492 No differences in allele frequencies were observed between autoimmune thyroid disease cases and controls for D8S284 variant
12819023 These findings demonstrate that papillary thyroid carcinoma cells synthesize unique post-translationally modified thyroglobulin and transferrin variants in situ.
12804099 Amplification generates two fragments of 3.5 and 5.0 kb that correspond to the exclusion or inclusion of a 1464-bp segment, respectively.
12022704 evaluated Tg content in the thyroid and in the serum of 108 patients suffering from benign or malignant thyroid disorders
11935320 a major locus for familial congenital hypothyroidism.

AA Sequence

MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSC      1 - 70
WCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWC     71 - 140
VDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHS    141 - 210
YNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRIL    211 - 280
QRRFLAVQSVISGRFRCPTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTR    281 - 350
QQGEPPSCAEGQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSG    351 - 420
LLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALG    421 - 490
TRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKKDGTMNKPTVGSFGFEINLQE    491 - 560
NQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVMETVLSSQTCEQTPERLFVPSCTTEGSYEDVQ    561 - 630
CFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFN    631 - 700
SECYCVDAEGQAIPGTRSAIGKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWR    701 - 770
QVQCNGPPEQVFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYP    771 - 840
SLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWCVDEAGQELEG    841 - 910
MRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVAKGIRLRNEDLGLPPLFPPRE    911 - 980
AFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCW    981 - 1050
CVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQAS   1051 - 1120
GAGTWCVDPASGEELRPGSSSSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWC   1121 - 1190
VMDSGEEVPGTRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPG   1191 - 1260
PLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVFILDELTARGF   1261 - 1330
CQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFT   1331 - 1400
DLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGSYSQD   1401 - 1470
EECIPCPVGFYQEQAGSLACVPCPVGRTTISAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGK   1471 - 1540
AFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTED   1541 - 1610
EACSFFTVSTTEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKK   1611 - 1680
GQGSTTTLQKRFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVLTQVQGGAIICG   1681 - 1750
LLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIKSLTPLEGTQDTFTNFQQVYL   1751 - 1820
WKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQAN   1821 - 1890
LWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDK   1891 - 1960
VKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSL   1961 - 2030
GIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSS   2031 - 2100
VVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQ   2101 - 2170
NCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAE   2171 - 2240
RRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREE   2241 - 2310
SEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRV   2311 - 2380
SLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEV   2381 - 2450
VSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRA   2451 - 2520
KAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFII   2521 - 2590
CPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFS   2591 - 2660
HFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSAD   2661 - 2730
GAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK                                   2731 - 2768
//

Text Mined References (160)

PMID Year Title
26963610 2016 Association of Cytotoxic T-Lymphocyte Antigen 4 (CTLA4) and Thyroglobulin (TG) Genetic Variants with Autoimmune Hypothyroidism.
26896794 2016 Long period fiber grating nano-optrode for cancer biomarker detection.
26777470 2016 Thyroglobulin gene mutations in Chinese patients with congenital hypothyroidism.
26595189 2016 Thyroglobulin From Molecular and Cellular Biology to Clinical Endocrinology.
26099577 2015 Correlation between thyroglobulin gene polymorphisms and autoimmune thyroid disease.
25895485 2015 Transient early increase in thyroglobulin levels post-radioiodine ablation in patients with differentiated thyroid cancer.
25893415 2015 Undetectable Thyroglobulin Levels in Poorly Differentiated Thyroid Carcinoma Patients Free of Macroscopic Disease After Initial Treatment: Are They Useful?
25633667 2015 Novel compound heterozygous Thyroglobulin mutations c.745+1G>A/c.7036+2T>A associated with congenital goiter and hypothyroidism in a Vietnamese family. Identification of a new cryptic 5' splice site in the exon 6.
25607926 2015 Thyroglobulin level in fine-needle aspirates for preoperative diagnosis of cervical lymph node metastasis in patients with papillary thyroid carcinoma: two different cutoff values according to serum thyroglobulin level.
25536321 2015 The relationship between iodine intake and serum thyroglobulin in the general population.
25213012 2014 Preoperative serum thyroglobulin concentration as a predictive factor of malignancy in small follicular and Hürthle cell neoplasms of the thyroid gland.
24762031 2014 Thyroglobulin as a biomarker of iodine deficiency: a review.
24735383 2014 Genotypes and phenotypes of congenital goitre and hypothyroidism caused by mutations in dual oxidase 2 genes.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
24565964 2014 Unreliability of the use of thyroglobulin concentration in postmortem blood samples in forensic diagnosis.
24460082 2014 Low but measurable stimulated serum thyroglobulin levels <2 µg/L frequently predict incomplete response in differentiated thyroid cancer patients.
24341425 2014 Serum thyroglobulin improves the sensitivity of the McGill Thyroid Nodule Score for well-differentiated thyroid cancer.
24064687 2013 Iodine contributes to thyroid autoimmunity in humans by unmasking a cryptic epitope on thyroglobulin.
24057177 2014 Elevated blood Hsp60, its structural similarities and cross-reactivity with thyroid molecules, and its presence on the plasma membrane of oncocytes point to the chaperonin as an immunopathogenic factor in Hashimoto's thyroiditis.
23949896 2014 Novel truncating thyroglobulin gene mutations associated with congenital hypothyroidism.
23933148 2013 Novel mutational mechanism in the thyroglobulin gene: imperfect DNA inversion as a cause for hereditary hypothyroidism.
23900865 2013 Lymph node metastases in papillary thyroid cancer detected by quantitative real-time polymerase chain reaction for thyroglobulin and cytokeratine-19.
23886742 2013 Optimized cutoff value and indication for washout thyroglobulin level according to ultrasound findings in patients with well-differentiated thyroid cancer.
23826916 2014 Thyroglobulin as early prognostic marker to predict remission at 18-24 months in differentiated thyroid carcinoma.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
23489940 2013 Postoperative-stimulated serum thyroglobulin measured at the time of 131I ablation is useful for the prediction of disease status in patients with differentiated thyroid carcinoma.
23455760 2013 Congenital hypothyroidism caused by a novel homozygous mutation in the thyroglobulin gene.
23360821 2013 Glycosylation of sera thyroglobulin antibody in patients with thyroid diseases.
23345097 2013 Thyroglobulin is a sensitive measure of both deficient and excess iodine intakes in children and indicates no adverse effects on thyroid function in the UIC range of 100-299 ?g/L: a UNICEF/ICCIDD study group report.
23242039 2013 Focus on high-risk DTC patients: high postoperative serum thyroglobulin level is a strong predictor of disease persistence and is associated to progression-free survival and overall survival.
23190420 2013 Factors associated with serum thyroglobulin levels in a population living in Belarus.
23164529 2013 New insights into thyroglobulin gene: molecular analysis of seven novel mutations associated with goiter and hypothyroidism.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22784463 2012 Clinical and genetic analysis of a compound heterozygous mutation in the thyroglobulin gene in a Chinese twin family with congenital goiter and hypothyroidism.
22662162 2012 Multiple SNPs in intron 41 of thyroglobulin gene are associated with autoimmune thyroid disease in the Japanese population.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22517745 2012 Human fibrocytes coexpress thyroglobulin and thyrotropin receptor.
22265031 2012 Epistasis between the HSD17B4 and TG polymorphisms is associated with premature ovarian failure.
22259066 2012 Evidence of a combined cytotoxic thyroglobulin and thyroperoxidase epitope-specific cellular immunity in Hashimoto's thyroiditis.
22170797 2012 Thyroid hyperactivity with high thyroglobulin in serum despite sufficient iodine intake in chronic cold adaptation in an Arctic Inuit hunter population.
22136267 2011 In differentiated thyroid cancer, an incomplete structural response to therapy is associated with significantly worse clinical outcomes than only an incomplete thyroglobulin response.
22136265 2011 Papillary thyroid carcinoma patients assessed to be at low or intermediary risk after primary treatment are at greater risk of long term recurrence if they are thyroglobulin antibody positive or do not have distinctly low thyroglobulin at initial assessment.
22098450 2012 Fine epitope mapping within the pathogenic thyroglobulin peptide 2340-2359: minimal epitopes retaining antigenicity across various MHC haplotypes are not necessarily immunogenic.
21958696 2012 Two novel mutations in the thyroglobulin gene as cause of congenital hypothyroidism: identification a cryptic donor splice site in the exon 19.
21757724 2011 Novel variant of thyroglobulin promoter triggers thyroid autoimmunity through an epigenetic interferon alpha-modulated mechanism.
21646855 2011 Prognostic value of post-thyroidectomy thyroglobulin levels in patients with differentiated thyroid cancer.
21636579 2011 Repeat motif-containing regions within thyroglobulin.
21476894 2011 Common variants of the thyroglobulin gene are associated with differentiated thyroid cancer risk.
21372558 2011 Thyroglobulin gene mutations in congenital hypothyroidism.
21039721 2011 The value of detectable thyroglobulin in patients with differentiated thyroid cancer after initial ¹³¹I therapy.
20972728 2010 Clinical, biochemical, and molecular findings in Argentinean patients with goitrous congenital hypothyroidism.
20972722 2010 Association of the TGrI29 microsatellite in thyroglobulin gene with autoimmune thyroiditis in a Argentinian population: a case-control study.
20960158 2010 Analysis of thyroglobulin gene polymorphisms in patients with autoimmune thyroiditis.
20864102 2011 Thyroglobulin gene is associated with premature ovarian failure.
20573721 2010 Antibodies to thyroid peroxidase arise spontaneously with age in NOD.H-2h4 mice and appear after thyroglobulin antibodies.
20486066 2010 Heterophile antibodies rarely influence the measurement of thyroglobulin and thyroglobulin antibodies in differentiated thyroid cancer patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20353937 2010 Cis and trans actions of the cholinesterase-like domain within the thyroglobulin dimer.
20215770 2010 Lack of association of common allelic variants in the thyroglobulin gene with Hashimoto's thyroiditis in young subjects with type 1 diabetes.
20182447 2010 Lack of a role for cross-reacting anti-thyroid antibodies in chronic idiopathic urticaria.
20173019 2010 Development of a sensitive and specific quantitative reverse transcription-polymerase chain reaction assay for blood thyroglobulin messenger ribonucleic acid in the follow-up of patients with differentiated thyroid carcinoma.
20089614 2010 Biallelic p.R2223H mutation in the thyroglobulin gene causes thyroglobulin retention and severe hypothyroidism with subsequent development of thyroid carcinoma.
19837936 2009 Six new mutations of the thyroglobulin gene discovered in taiwanese children presenting with thyroid dyshormonogenesis.
19776016 2009 Employing a recombinant HLA-DR3 expression system to dissect major histocompatibility complex II-thyroglobulin peptide dynamism: a genetic, biochemical, and reverse immunological perspective.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19633549 2009 Mutations of the thyroglobulin gene and its relevance to thyroid disorders.
19509106 2009 The p.A2215D thyroglobulin gene mutation leads to deficient synthesis and secretion of the mutated protein and congenital hypothyroidism with wide phenotype variation.
19438905 2010 Molecular analysis of congenital goitres with hypothyroidism caused by defective thyroglobulin synthesis. Identification of a novel c.7006C>T [p.R2317X] mutation and expression of minigenes containing nonsense mutations in exon 7.
19438904 2010 Clinical associations of the genetic variants of CTLA-4, Tg, TSHR, PTPN22, PTPN12 and FCRL3 in patients with Graves' disease.
19416000 2009 Identification of a neck lump as a lymph node metastasis from an occult contralateral papillary microcarcinoma of the thyroid: key role of thyroglobulin assay in the fine-needle aspirate.
19404338 2009 Expression of thyroglobulin on follicular dendritic cells of thyroid mucosa-associated lymphoid tissue (MALT) lymphoma.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19194833 2009 The prevalence of iodine deficiency, serum thyroglobulin, anti-thyroglobulin and thyroid peroxidase antibody levels in the urban areas of Kayseri, Central Anatolia.
19034705 2008 Association of the thyroglobulin gene polymorphism with autoimmune thyroid disease in Chinese population.
18755875 2008 Association of CD40 and thyroglobulin genes with later-onset Graves' disease in Taiwanese patients.
18656705 2008 Thyroglobulin polymorphisms in Tunisian patients with autoimmune thyroid diseases (AITD).
18636294 2008 Lymph node status influences follow-up thyroglobulin levels in papillary thyroid cancer.
18631008 2008 Phenotypic variation among four family members with congenital hypothyroidism caused by two distinct thyroglobulin gene mutations.
18566446 2008 Thyroglobulin peptides associate in vivo to HLA-DR in autoimmune thyroid glands.
18514160 2008 Phosphodiesterase 8B gene variants are associated with serum TSH levels and thyroid function.
18385936 2008 Exon 33 T/T genotype of the thyroglobulin gene is a susceptibility gene for Graves' disease in Taiwanese and exon 12 C/C genotype protects against it.
18271683 2008 Anti-Helicobacter Pylori, anti-thyroid peroxidase, anti-thyroglobulin and anti-gastric parietal cells antibodies in Czech population.
18243140 2008 Thyroglobulin mRNA expression in peripheral blood lymphocytes of healthy subjects and patients with thyroid disease.
18166820 2008 The follow-up of patients with differentiated thyroid cancer and undetectable thyroglobulin (Tg) and Tg antibodies during ablation.
17911408 2007 Recurrence of the p.R277X/p.R1511X compound heterozygous mutation in the thyroglobulin gene in unrelated families with congenital goiter and hypothyroidism: haplotype analysis using intragenic thyroglobulin polymorphisms.
17902201 2007 Biological variation of thyroid autoantibodies and thyroglobulin.
17854396 2008 Molecular characteristics in papillary thyroid cancers (PTCs) with no 131I uptake.
17671725 2007 Quantitative measurement of telomerase reverse transcriptase, thyroglobulin and thyroid transcription factor 1 mRNAs in anaplastic thyroid carcinoma tissues and cell lines.
17644307 Dissecting genetic heterogeneity in autoimmune thyroid diseases by subset analysis.
17550957 2007 Association between a C/T polymorphism in exon 33 of the thyroglobulin gene is associated with relapse of Graves' hyperthyroidism after antithyroid withdrawal in Taiwanese.
17532758 2007 Congenital hypothyroidism with goitre caused by new mutations in the thyroglobulin gene.
17526951 2006 The predictive value of CTLA-4 and Tg polymorphisms in the recurrence of Graves' disease after antithyroid withdrawal.
17278897 2007 Predictive value of the preablation serum thyroglobulin level after thyroidectomy is combined with postablation 131I whole body scintigraphy for successful ablation in patients with differentiated thyroid carcinoma.
17244789 2007 Thyroglobulin gene mutations producing defective intracellular transport of thyroglobulin are associated with increased thyroidal type 2 iodothyronine deiodinase activity.
16679516 2006 A single chondroitin 6-sulfate oligosaccharide unit at Ser-2730 of human thyroglobulin enhances hormone formation and limits proteolytic accessibility at the carboxyl terminus. Potential insights into thyroid homeostasis and autoimmunity.
16646680 2006 Possible interaction between HLA-DRbeta1 and thyroglobulin variants in Graves' disease.
16477365 2006 A novel compound heterozygous mutation in the thyroglobulin gene resulting in congenital goitrous hypothyroidism with high serum triiodothyronine levels.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16403815 2006 Clinical case seminar: metastatic follicular thyroid carcinoma arising from congenital goiter as a result of a novel splice donor site mutation in the thyroglobulin gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16271015 2005 Nonsense-associated alternative splicing of the human thyroglobulin gene.
16260629 2005 Pendrin is a novel in vivo downstream target gene of the TTF-1/Nkx-2.1 homeodomain transcription factor in differentiated thyroid cells.
16230285 [Thyroglobulin mRNA detection in the follow-up of thyroid carcinomas].
15785246 2005 Clinical value of different responses of serum thyroglobulin to recombinant human thyrotropin in the follow-up of patients with differentiated thyroid carcinoma.
15769978 2005 A new case of congenital goiter with hypothyroidism caused by a homozygous p.R277X mutation in the exon 7 of the thyroglobulin gene: a mutational hot spot could explain the recurrence of this mutation.
15579800 2004 Common allelic variants of exons 10, 12, and 33 of the thyroglobulin gene are not associated with autoimmune thyroid disease in the United Kingdom.
15579752 2004 Factors influencing the basal and recombinant human thyrotropin-stimulated serum thyroglobulin in patients with metastatic thyroid carcinoma.
15562032 2005 Type I interferons modulate the expression of thyroid peroxidase, sodium/iodide symporter, and thyroglobulin genes in primary human thyrocyte cultures.
15494458 2005 PAX8, TITF1, and FOXE1 gene expression patterns during human development: new insights into human thyroid development and thyroid dysgenesis-associated malformations.
15272924 2004 Association of a thyroglobulin gene polymorphism with Hashimoto's thyroiditis in the Japanese population.
15070908 2004 Elevation in serum thyroglobulin during prolonged Antarctic residence: effect of thyroxine supplement in the polar 3,5,3'-triiodothyronine syndrome.
14764582 2004 The acetylcholinesterase homology region is essential for normal conformational maturation and secretion of thyroglobulin.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14657345 2003 Amino acid substitutions in the thyroglobulin gene are associated with susceptibility to human and murine autoimmune thyroid disease.
14633662 2004 Risk of non-medullary thyroid cancer influenced by polymorphic variation in the thyroglobulin gene.
14557492 2003 Association of a rare thyroglobulin gene microsatellite variant with autoimmune thyroid disease.
12973666 2003 Common and unique susceptibility loci in Graves and Hashimoto diseases: results of whole-genome screening in a data set of 102 multiplex families.
12819023 2003 Proteomic and postproteomic characterization of keratan sulfate-glycanated isoforms of thyroglobulin and transferrin uniquely elaborated by papillary thyroid carcinomas.
12804099 2003 Identification and characterization of a novel large insertion/deletion polymorphism of 1464 base pair in the human thyroglobulin gene.
12709678 2003 Relationship of clinical features and laboratory parameters to thyroid echogenicity measured by standardized grey scale ultrasonography in patients with Hashimoto's thyroiditis.
12679418 2003 A consensus report of the role of serum thyroglobulin as a monitoring method for low-risk patients with papillary thyroid carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477859 2003 Role of the asialoglycoprotein receptor in binding and entry of hepatitis C virus structural proteins in cultured human hepatocytes.
12387814 2002 The hormonogenic tyrosine 5 of porcine thyroglobulin is sulfated.
12022704 2002 A study of thyroglobulin concentration in the thyroid and serum of patients with different thyroid disorders.
11916630 2002 Binding of heparin to human thyroglobulin (Tg) involves multiple binding sites including a region corresponding to a binding site of rat Tg.
11581009 2001 Genomic organization of the human thyroglobulin gene: the complete intron-exon structure.
11294872 2001 Role of extracellular molecular chaperones in the folding of oxidized proteins. Refolding of colloidal thyroglobulin by protein disulfide isomerase and immunoglobulin heavy chain-binding protein.
11124863 2000 Genomic organization of the 5' region of the human thyroglobulin gene.
10636893 2000 Protein-disulfide isomerase (PDI) in FRTL5 cells. pH-dependent thyroglobulin/PDI interactions determine a novel PDI function in the post-endoplasmic reticulum of thyrocytes.
10524569 1999 Genomic organization of the 3' region of the human thyroglobulin gene.
10487692 1999 Expression of the Na+/I- symporter gene in human thyroid tumors: a comparison study with other thyroid-specific genes.
10448091 1999 Sulfated tyrosines of thyroglobulin are involved in thyroid hormone synthesis.
10199792 1999 Two novel cysteine substitutions (C1263R and C1995S) of thyroglobulin cause a defect in intracellular transport of thyroglobulin in patients with congenital goiter and the variant type of adenomatous goiter.
10049727 1999 Involvement of oxidative reactions and extracellular protein chaperones in the rescue of misassembled thyroglobulin in the follicular lumen.
9492085 1998 Megalin (gp330): a putative endocytic receptor for thyroglobulin (Tg).
9287346 1997 Identification of the membrane receptor binding domain of thyroglobulin. Insights into quality control of thyroglobulin biosynthesis.
9186272 1997 The revised 8307 base pair coding sequence of human thyroglobulin transiently expressed in eukaryotic cells.
9006956 1997 Multiple molecular chaperones complex with misfolded large oligomeric glycoproteins in the endoplasmic reticulum.
8797845 1996 Characterization of the type-1 repeat from thyroglobulin, a cysteine-rich module found in proteins from different families.
8615697 1996 Glycosylation in human thyroglobulin: location of the N-linked oligosaccharide units and comparison with bovine thyroglobulin.
8530385 1995 N-glycans modulate in vivo and in vitro thyroid hormone synthesis. Study at the N-terminal domain of thyroglobulin.
8269951 1993 Preferential sites of proteolytic cleavage of bovine, human and rat thyroglobulin. The use of limited proteolysis to detect solvent-exposed regions of the primary structure.
8094490 1993 Thyroglobulin gene point mutation associated with non-endemic simple goitre.
7793989 1995 Characterization of hormonogenic sites in an N-terminal, cyanogen bromide fragment of human thyroglobulin.
7593451 1995 A 138-nucleotide deletion in the thyroglobulin ribonucleic acid messenger in a congenital goiter with defective thyroglobulin synthesis.
4043966 1985 Mapping of human thyroglobulin gene on the long arm of chromosome 8 by in situ hybridization.
4006519 1985 The thyroglobulin gene resides on chromosome 8 in man and on chromosome 7 in the rat.
3971976 1985 Sequence of the 5'-end quarter of the human-thyroglobulin messenger ribonucleic acid and of its deduced amino-acid sequence.
3967888 1985 Localization of the thyroglobulin gene by in situ hybridization to human chromosomes.
3681978 1987 Structural organization of the 5' region of the thyroglobulin gene. Evidence for intron loss and "exonization" during evolution.
3595599 1987 Primary structure of human thyroglobulin deduced from the sequence of its 8448-base complementary DNA.
3211159 1988 Evidence that serum amyloid P component binds to mannose-terminated sequences of polysaccharides and glycoproteins.
3016640 1986 The human thyroglobulin gene is over 300 kb long and contains introns of up to 64 kb.
2991855 1985 An unusually long poly(purine)-poly(pyrimidine) sequence is located upstream from the human thyroglobulin gene.
2914619 1989 Hormone synthesis in human thyroglobulin: possible cleavage of the polypeptide chain at the tyrosine donor site.
2760035 1989 Consensus sequences for early iodination and hormonogenesis in human thyroglobulin.
1939080 1991 Thyroglobulin processing by thyroidal proteases. Major sites of cleavage by cathepsins B, D, and L.
1639210 1992 Identification of a minor Tg mRNA transcript in RNA from normal and goitrous thyroids.
1371467 1992 A major human thyroglobulin epitope defined with monoclonal antibodies is mainly recognized by human autoantibodies.