Property Summary

NCBI Gene PubMed Count 16
PubMed Score 62.28
PubTator Score 94.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 3.069 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 2.3e-02
oligodendroglioma -1.500 4.3e-02
glioblastoma -1.200 1.7e-02
medulloblastoma -1.100 3.5e-03
medulloblastoma, large-cell -1.600 2.4e-05
adult high grade glioma -1.100 1.2e-03
ovarian cancer 1.100 1.7e-04

 GO Function (1)

Gene RIF (4)

PMID Text
23684607 TCF3/E2A is Conserved Specific Coregulators of the p21:PUMA Expression Ratio.
22723017 Characterization of the core promoters controlling the expression of PRPF31 and TFPT, a bi-directional gene-pair.
17395368 FB1 is an important binding partner and a functional regulator of U19/EAF2, EAF1, and/or ELL.
17041757 Although p53 is a main regulator of apoptosis in mammalian cells, the Tfpt induced apoptosis appears p53-independent.

AA Sequence

MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRERDEEEEAARGR      1 - 70
RRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVL     71 - 140
EDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPEL    141 - 210
APVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASPASD                               211 - 253
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23684607 2013 A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723017 2012 Expression of PRPF31 and TFPT: regulation in health and retinal disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17395368 2007 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17041757 2006 Apoptosis promoted by up-regulation of TFPT (TCF3 fusion partner) appears p53 independent, cell type restricted and cell density influenced.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10644725 2000 Molecular cloning and characterization of Amida, a novel protein which interacts with a neuron-specific immediate early gene product arc, contains novel nuclear localization signals, and causes cell death in cultured cells.
10086727 1999 Identification of a novel molecular partner of the E2A gene in childhood leukemia.