Property Summary

NCBI Gene PubMed Count 112
PubMed Score 224.31
PubTator Score 288.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
nephrosclerosis 1.083 3.9e-02
malignant mesothelioma -7.200 4.9e-10
posterior fossa group A ependymoma 2.200 3.2e-05
glioblastoma 2.400 7.3e-03
group 3 medulloblastoma 2.500 5.8e-04
cystic fibrosis 1.064 4.0e-03
atypical teratoid / rhabdoid tumor 3.600 3.1e-04
medulloblastoma, large-cell 3.400 2.5e-03
primitive neuroectodermal tumor 1.100 6.9e-03
adrenocortical adenoma -2.800 1.1e-02
chronic kidney disease 2.500 2.9e-02
tuberculosis -3.700 3.5e-08
intraductal papillary-mucinous adenoma (... -4.900 4.0e-05
intraductal papillary-mucinous carcinoma... -4.800 7.3e-05
intraductal papillary-mucinous neoplasm ... -4.700 2.0e-03
lung cancer -1.200 4.2e-03
colon cancer -1.500 5.1e-03
interstitial cystitis 5.400 7.3e-04
pediatric high grade glioma 2.100 1.2e-03
inflammatory breast cancer -2.100 2.9e-02
pulmonary arterial hypertension -2.900 4.5e-02
lung carcinoma -1.100 1.6e-10
pterygium -1.200 1.4e-02
ulcerative colitis 2.600 1.3e-02
ovarian cancer -5.900 8.9e-11
pituitary cancer -3.100 2.0e-06
dermatomyositis 1.200 2.3e-02

Gene RIF (89)

PMID Text
26318044 Data show that silencing tumor-endothelial cells (EC) for trypsinogen 4 accumulated tissue factor pathway inhibitor-2 (TFPI-2) in the matrix.
26313014 Its methylation is a prognostic biomarker for hepatocellular carcinoma after hepatectomy.
25973077 DNA methylation of TFPI2 may play an important role in the carcinogenesis of cervical cancer and that the differential methylation of TFPI2 may at least partially explain the disparity in cervical cancer incidence between Uygur and Han women.
25902909 Hypermethylation of TFPI2 promoter is increased in inflamed colon tissue.
25755762 our findings suggested that the differential expression of MMP-2 and TFPI-2 have a negative correlation in pancreatic carcinoma
25755719 Our finding suggests that the decreased expression of TFPI-2 may play an important role in the carcinogenesis and progression, and may become a new adjunct marker in the diagnosis and prognosis in cholangiocarcinoma
25414083 TMPRSS4 is upregulated by silencing of TFPI-2 through aberrant DNA methylation and contributes to oncogenesis in non-small cell lung cancer.
25262870 TFPI-2 in platelets from normal or pregnant subjects and in plasma from pregnant women binds FV/Va and regulates intrinsic coagulation and fibrinolysis
25179542 TFPI-2 is a down-regulated tumor suppressor gene in oral squamous cell carcinoma, probably involving epigenetic silencing mechanisms. The loss of TFPI-2 expression is a key event for oral tumorigenesis, especially in the process of tumor metastasis.
25036127 regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2
24591127 TFPI-2 downregulation can contribute to tumor invasion of hepatocellular carcinoma cells through alteration in the expression of metastasis-related genes.
23805888 TFPI2 is a novel serum marker for ovarian clear cell adenocarcinoma and neoplastic transformation from endometriosis.
23497249 Low or negative expression of TFPI-2 is associated with breast cancer progression, recurrence and poor survival outcome after breast cancer surgery. TFPI-2 expression in breast tumors is a potential prognostic tool for breast cancer patients.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of tissue factor pathway inhibitor 2 (TFPI2) in peptide-treated PBMCs
23300768 The C-terminus of TFPI-2 encodes for antimicrobial activity, and may be released during wounding.
23108564 TFPI2 methylation in serum tended to be detected more easily in patients with advanced hepatocellular carcinoma (HCC) and might be used as a predictor of HCC progression.
23032906 The present work demonstrated that the epigenetic inactivation of TFPI-2 by promoter hypermethylation was a frequent and tumor-specific event in glioblastoma, and TFPI-2 promoter methylation might be considered as a prognostic marker in glioblastoma.
22449186 Methylation was found in 28.2, 33.3 and 33.3% of grade 1, 2 and 3 esophageal dysplasia, and 67% of primary esophageal cancer, but no methylation was found in normal mucosa.
22399594 results confirm that detection of methylated TFPI2 in serum DNA was derived from colorectal cancer and could serve as a marker of surgical outcome
22232300 recombined plasmid pEGFP-C1-TFPI-2 actually interacted with native RASSF1C
22208663 There was a close association between the expression of tissue factor pathway inhibitor-2 (TFPI-2) and tumor cell apoptosis and angiogenesis in patients with cervical cancer.
22203034 TFPI-2 expression caused invasion and proliferation impair and induced apoptosis in TFPI-2 regulated BeWo and JEG-3 cells. It provides a clue for potential role of TFPI-2 in trophoblast.
22110206 Serum TFPI2 methylation is associated with gastric cancer.
22052167 Promoter hypermethylation of TFPI-2 is frequent and specific event in pediatric acute myeloid leukemia.
21984372 inverse expression of CD24 and TFPI-2 was observed by immunohistochemical analysis of primary breast cancers (N = 1,174). TFPI-2 expression was highest in CD24 negative samples and lowered with increasing CD24 expression
21983100 TFPI-2 methylation is associated with non-small cell lung cancer.
21820798 TFPI2 methylation was significant in the sera of patients with large, poorly differentiated carcinoma, deep invasion, lymph node metastasis, or distant metastasis. TFPI2 methylation was observed more frequently according to the progression of TNM stage.
21621497 Results demonstrate the feasibility of using TFPI2 methylation and quantify human long DNA with fluorescent quantitative Alu PCR in fecal samples as a new noninvasive test for CRC.
21530612 Our findings underscore the important role of TFPI-2 as a tumor suppressor gene
21515313 Results showed that TFPI2 expression was not affected by with VLDL lipoproteins, but was induced by thrombin in THP-1 and monocyte-derived macrophages.
21224345 Findings define a functional involvement for miR-616 and TFPI-2 in the development and maintenance of androgen-independent prostate cancer.
21062455 Epigenetic inactivation of TFPI-2 by promoter hypermethylation is a frequent and tumor specific event in nasopharyngeal carcinoma
21036731 Aberrant methylation of the TFPI2 gene was detected in 7 out of 38 (18%) primary gastric carcinomas, suggesting that the methylation of TFPI2 is frequently observed in gastric carcinomas.
20537494 TFPI-2 influences smooth muscle cell proliferation and apoptosis in vitro in response to fluid shear stress.
20530429 TFPI2 may act as a tumour suppressor in colorectal carcinomas and TFPI2 methylation may present a potential risk of malignancy in colorectal cancer.
20377370 these data indicate that TFPI-2 inhibits esophageal tumor invasion and angiogenesis both in vitro and in vivo.
20347477 Placenta may be the main site of the high level of TFPI-2 production in maternal circulation
20335518 Expression, DNA methylation and histone modifications of TFPI2, a presumed tumor suppressor, and that of other genes in the 7q21 imprinted gene cluster in prostate cancer, were analysed.
20113832 Aberrant methylation of TFPI2 promoter CpG island occurred not only in gastric cancer (GC) cells but also in primary GC tissues at a high frequency, suggesting that epigenetic silencing of TFPI2 may contribute to gastric carcinogenesis.
20018303 TFPI-2 plays a significant role in the growth, invasion, and metastasis of pancreatic carcinoma cell in vitro and in vivo, and has potential in anticancer therapy.
20015200 study provides evidence that inactivation of TFPI-2 synthesis might promote tumour invasion by a mechanism dependent on regulation of MMP-1, -2, -3, -7 and of ERK signalling pathway
19936309 TFPI-2 expression may strongly inhibit the migration ability of human Tenon's capsule fibroblasts in vitro.
19902129 It was found that heparin calcium induced b-strands in hTFPI-2/ KD3C to different extents depending on the ratio of hTFPI-2/KD3C and heparin calcium.
19763915 TFPI-2 plays a significant role in the invasion and metastasis of pancreatic carcinoma cell in vitro and in vivo. TFPI-2 is an independent prognostic factor for pancreatic carcinoma.
19571260 Paternal imprinting (maternal expression) at TFPI2 is conserved among humans, mice and swine.
19460752 Knockdown of tissue factor pathway inhibitor 2 (TFPI2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19435926 Potential of TFPI2 as a biomarker for the early detection of CRC using stool DNA-based assays.
19288010 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19212621 epigallocatechin gallate inhibits growth and induces apoptosis in renal cell carcinoma through TFPI-2 overexpression
19103149 Initial description of TFPI-2 internalization and translocation to the nucleus in a number of cells.
19102937 The expression of TFPI-2 is correlated with clinical stage and differentiation of pancreatic carcinoma.
19081094 Tissue factor pathway inhibitor-2 gene methylation is associated with low expression in carotid atherosclerotic plaques.
18810851 Genotyping for MspI gene polymorphisms may be clinically relevant to define the predisposition to the major clinical manifestations in mixed cryoglobulinemic syndrome.
18480470 Results reveals a novel placenta-specific transcript, TFPI2, which is expressed from the maternal allele.
18401718 Collectively, our results demonstrate that treatment of HT-1080 fibrosarcoma cells exogenously with either TFPI-2 or its first Kunitz domain mutant R24K activates caspase-mediated, pro-apoptotic signaling pathways resulting in apoptosis.
18097563 keratoepithelin induces elevated TFPI2 transcript levels in neuroblastoma cells without alterations of MYCN expression.
18053161 The CpG islands in TFPI-2 promoter was hypermethylated in highly invasive breast cancer cell line, and DNA methylation in the entire promoter region caused TFPI-2 repression by inducing inactive chromatin structure and decreasing KLF6 binding.
17558445 The detailed conformational changes of the heated protein observed by fourier transform infrared spectroscopy, circular dichroism and Raman spectroscopy revealed that hTFPI-2/KD1 was thermally stable
17464989 TFPI-2 is frequently silenced in hepatocellular carcinoma via epigenetic alterations, including promoter methylation and histone deacetylation; ectopic overexpression of TFPI-2 significantly suppressed the proliferation and invasiveness of HCC cells
17372906 Results showed that TFPI-2 is silenced in malignant melanomas by methylation of its promoter CGI and suggested that its silencing is involved in melanoma metastasis.
17352822 A new 289-nucleotide splice variant of the TFPI-2 transcript consists of complete exons II & V, fused with several nucleotides derived from exons III & IV, & 6 nucleotides derived from intron C. It lacks either a 5'-TR) or a 3'-poly (A)+ tail.
17208328 Observational study of gene-disease association. (HuGE Navigator)
17138934 Our data suggest that TFPI-2 may be an important regulator of aberrant angiogenesis associated with tumor growth/metastasis, cardiovascular diseases, chronic inflammation, or diabetes.
17023682 data suggest that VEGF-upregulation of TFPI-2 expression in endothelial cells may represent a mechanism for negative feedback regulation and modulation of its pro-angiogenic action on endothelial cells.
16965396 Aberrant methylation of tissue factor pathway inhibitor 2 is associated with pancreatic carcinoma.
16641089 role of TFPI-2 as a maintenance factor of extracellular remodeling suggests the indirect function of ADAMTS1 as an additional homeostatic player by its ability to alter the extracellular location of TFPI-2
16580726 Preeclampsia and IUGR showed distinct distributions of TFPI-2.
16247609 Observational study of genotype prevalence. (HuGE Navigator)
15932872 x-ray crystallographic analysis of Kunitz domain 1 of TFPI-2 in complex with trypsin
15685245 These results suggest that silencing of the TFPI-2 gene by hypermethylation might contribute to tumour progression in NSCLC.
15592528 Restored expression of the TFPI-2 gene in nonexpressing pancreatic cancer cells resulted in marked suppression in their proliferation, migration, and invasive potential.
15467913 data suggest that gC1qR may participate in tissue remodeling and inflammation by localizing TFPI-2 to the pericellular environment to modulate local protease activity and regulate High Molecular Weight Kininogen activation
15221977 TNF treatment at 41 degrees C significantly reduced clotting activity, TF protein and mRNA as well as TFPI-2 mRNA.
15183047 variations in the TFPI-2 gene and its promoter region
14983234 human and murine TFPI-2 have different functions in liver regulation during inflammation in the two species
14970225 analysis of the reactive site in the first Kunitz-type domain of TFPI2
14678821 Computer model of the interaction of human TFPI-2 Kunitz-type serine protease inhibitor with human plasmin [letter]
14623891 thrombin, through PAR-1 signaling, up-regulates the synthesis of TFPI-2 via a MAPK/COX-2-dependent pathway
14558946 Expression of TFPI-2 may strongly inhibit the invasive ability of ovarian tumor cells in vitro, but has no effect on the migratory ability.
14525759 secretion of inhibitory TFPI-2 by a highly metastatic tumor cell markedly inhibits its growth and metastasis
12921785 Bovine TFPI2 was compared to human TFPI2.
12881707 These studies establish that TFPI-2 is transcriptionally silenced through promoter methylation in SNB19 cells.
12876637 The expression of TFPI-2 diminishes with an increasing degree of malignancy, which may suggest a role for TFPI-2 in the maintenance of tumor stability and inhibition of the growth of neoplasms.
12787920 These data provide evidence that tissue factor pathway inhibitor-2 does not bind to matrix metalloproteinases-2, -9 or -1, or regulate matrix metalloproteinase-1, in the extracellular matrix.
12757776 the minimal TFPI2 promoter is located between -166 and -111 from the translation start site; three transcription initiation sites and several putative transcription factor binding sites were identified, and potential regulatory regions were characterized.
12738994 induced by various pathways in human glioma cells
12632077 methylation of TFPI-2 gene is not the sole cause of its silencing
12606321 the villous cytotrophoblast and syncytiotrophoblast are both important sites of TFPI-2 synthesis in the human placenta
11840337 highly expressed in non-invasive cells but undetectable in highly invasive human glioma cells

AA Sequence

MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCE      1 - 70
GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFP     71 - 140
DEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAK    141 - 210
ALKKKKKMPKLRFASRIRKIRKKQF                                                 211 - 235
//

Text Mined References (114)

PMID Year Title
26318044 2015 Trypsinogen 4 boosts tumor endothelial cells migration through proteolysis of tissue factor pathway inhibitor-2.
26313014 2016 Methylation of tissue factor pathway inhibitor 2 as a prognostic biomarker for hepatocellular carcinoma after hepatectomy.
25973077 2015 Hypermethylation of TFPI2 correlates with cervical cancer incidence in the Uygur and Han populations of Xinjiang, China.
25902909 2015 Hypermethylation of ITGA4, TFPI2 and VIMENTIN promoters is increased in inflamed colon tissue: putative risk markers for colitis-associated cancer.
25755762 2015 Correlation and prognostic significance of MMP-2 and TFPI-2 differential expression in pancreatic carcinoma.
25755719 2015 Decreased expression of TFPI-2 correlated with increased expression of CD133 in cholangiocarcinoma.
25414083 2015 Methylation-induced downregulation of TFPI-2 causes TMPRSS4 overexpression and contributes to oncogenesis in a subset of non-small-cell lung carcinoma.
25262870 2014 Platelets contain tissue factor pathway inhibitor-2 derived from megakaryocytes and inhibits fibrinolysis.
25179542 2014 Promoter hypermethylation and silencing of tissue factor pathway inhibitor-2 in oral squamous cell carcinoma.
25036127 2014 Regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2 (LSD1 and LSD2).
24591127 2013 Tissue factor pathway inhibitor-2 silencing promotes hepatocellular carcinoma cell invasion in vitro.
24333728 2014 Protein phosphatase complex PP5/PPP2R3C dephosphorylates P-glycoprotein/ABCB1 and down-regulates the expression and function.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23805888 2013 Secretome-based identification of TFPI2, a novel serum biomarker for detection of ovarian clear cell adenocarcinoma.
23497249 2013 Low expression of TFPI-2 associated with poor survival outcome in patients with breast cancer.
23300768 2012 Tissue factor pathway inhibitor 2 is found in skin and its C-terminal region encodes for antibacterial activity.
23108564 2013 Detection of TFPI2 methylation in the serum of hepatocellular carcinoma patients.
23032906 2012 Associations between TFPI-2 methylation and poor prognosis in glioblastomas.
22866126 2011 Tissue factor pathway inhibitor-2 inhibits the growth and invasion of hepatocellular carcinoma cells and is inactivated in human hepatocellular carcinoma.
22449186 2012 Methylation of TFPI-2 is an early event of esophageal carcinogenesis.
22399594 2012 Methylation of TFPI2 no longer detected in the serum DNA of colorectal cancer patients after curative surgery.
22232300 2012 Tissue factor pathway inhibitor-2 may interact with nuclear protein RASSF1C.
22208663 2012 Reduced expression of tissue factor pathway inhibitor-2 contributes to apoptosis and angiogenesis in cervical cancer.
22203034 2012 Effects of tissue factor pathway inhibitor-2 expression on biological behavior of BeWo and JEG-3 cell lines.
22110206 2011 Detection of TFPI2 methylation in the serum of gastric cancer patients.
22052167 2012 Promoter of TFPI-2 is hypermethylated in Chinese pediatric acute myeloid leukemia.
21984372 2012 CD24 promotes tumor cell invasion by suppressing tissue factor pathway inhibitor-2 (TFPI-2) in a c-Src-dependent fashion.
21983100 2012 TFPI-2 methylation predicts poor prognosis in non-small cell lung cancer.
21820798 2011 Detection of TFPI2 methylation in the serum of colorectal cancer patients.
21621497 2012 Detection of methylated tissue factor pathway inhibitor 2 and human long DNA in fecal samples of patients with colorectal cancer in China.
21530612 2011 Knockdown of TFPI-2 promotes migration and invasion of glioma cells.
21515313 2011 Tissue factor pathway inhibitor 2 is induced by thrombin in human macrophages.
21224345 2011 MicroRNA-616 induces androgen-independent growth of prostate cancer cells by suppressing expression of tissue factor pathway inhibitor TFPI-2.
21062455 2010 TFPI-2 is a putative tumor suppressor gene frequently inactivated by promoter hypermethylation in nasopharyngeal carcinoma.
21036731 2010 Methylation of the TFPI2 gene is frequently detected in advanced gastric carcinoma.
20537494 2010 Tissue factor pathway inhibitor-2 is induced by fluid shear stress in vascular smooth muscle cells and affects cell proliferation and survival.
20530429 2010 Methylation of TFPI2 gene is frequently detected in advanced well-differentiated colorectal cancer.
20377370 2009 A novel role for tissue factor pathway inhibitor-2 in the therapy of human esophageal carcinoma.
20347477 2010 Changes of plasma and placental tissue factor pathway inhibitor-2 in women with preeclampsia and normal pregnancy.
20335518 Epigenetic inactivation of the placentally imprinted tumor suppressor gene TFPI2 in prostate carcinoma.
20113832 2010 Tissue factor pathway inhibitor 2 (TFPI2) is frequently silenced by aberrant promoter hypermethylation in gastric cancer.
20018303 2011 Expression of tissue factor pathway inhibitor 2 in human pancreatic carcinoma and its effect on tumor growth, invasion, and migration in vitro and in vivo.
20015200 2011 TFPI-2 silencing increases tumour progression and promotes metalloproteinase 1 and 3 induction through tumour-stromal cell interactions.
19936309 2009 Human tissue factor pathway inhibitor-2 suppresses the wound-healing activities of human Tenon's capsule fibroblasts in vitro.
19902129 2009 Expression and characterization of Kunitz domain 3 and C-terminal of human tissue factor pathway inhibitor-2.
19763915 2010 Prognostic significance of tissue factor pathway inhibitor-2 in pancreatic carcinoma and its effect on tumor invasion and metastasis.
19571260 2009 Characterization of conserved and nonconserved imprinted genes in swine.
19435926 2009 Methylation of TFPI2 in stool DNA: a potential novel biomarker for the detection of colorectal cancer.
19288010 2009 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19212621 2009 EGCG inhibits growth and induces apoptosis in renal cell carcinoma through TFPI-2 overexpression.
19103149 2009 Human tissue factor pathway inhibitor-2 is internalized by cells and translocated to the nucleus by the importin system.
19102937 2008 [Expression of TFPI-2 gene in pancreatic carcinoma and its prognostic significance].
19081094 2009 Tissue factor pathway inhibitor-2 gene methylation is associated with low expression in carotid atherosclerotic plaques.
18810851 [Fibronectin gene polymorphisms and clinical manifestations of mixed cryoglobulinemic syndrome: increased risk of lymphoma associated to MspI DD and HaeIII AA genotypes].
18480470 2008 Comparative analysis of human chromosome 7q21 and mouse proximal chromosome 6 reveals a placental-specific imprinted gene, TFPI2/Tfpi2, which requires EHMT2 and EED for allelic-silencing.
18401718 2008 Human tissue factor pathway inhibitor-2 induces caspase-mediated apoptosis in a human fibrosarcoma cell line.
18097563 2008 Keratoepithelin reverts the suppression of tissue factor pathway inhibitor 2 by MYCN in human neuroblastoma: a mechanism to inhibit invasion.
18053161 2007 Tissue factor pathway inhibitor-2 was repressed by CpG hypermethylation through inhibition of KLF6 binding in highly invasive breast cancer cells.
17558445 2007 Spectroscopic analysis on the effect of temperature on Kunitz domain 1 of human tissue factor pathway inhibitor-2.
17464989 2007 Tissue factor pathway inhibitor-2 as a frequently silenced tumor suppressor gene in hepatocellular carcinoma.
17372906 2007 Silencing of tissue factor pathway inhibitor-2 gene in malignant melanomas.
17352822 2007 Identification of a human TFPI-2 splice variant that is upregulated in human tumor tissues.
17208328 2007 Influence of MMP-2 and MMP-9 promoter polymorphisms on gene expression and clinical outcome of non-small cell lung cancer.
17138934 2007 Adenovirus-mediated expression of tissue factor pathway inhibitor-2 inhibits endothelial cell migration and angiogenesis.
17023682 2006 Tissue factor pathway inhibitor-2 is upregulated by vascular endothelial growth factor and suppresses growth factor-induced proliferation of endothelial cells.
16965396 2006 Diagnostic utility of aberrant methylation of tissue factor pathway inhibitor 2 in pure pancreatic juice for pancreatic carcinoma.
16641089 2006 ADAMTS1 interacts with, cleaves, and modifies the extracellular location of the matrix inhibitor tissue factor pathway inhibitor-2.
16580726 Paradoxical discrepancy between the serum level and the placental intensity of PP5/TFPI-2 in preeclampsia and/or intrauterine growth restriction: possible interaction and correlation with glypican-3 hold the key.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16247609 2006 Analysis of sequence variations in the promoter region of the human tissue factor pathway inhibitor 2 gene in apoplectic patients and blood donors.
15932872 2005 Crystal structure of Kunitz domain 1 (KD1) of tissue factor pathway inhibitor-2 in complex with trypsin. Implications for KD1 specificity of inhibition.
15685245 2005 Expression and methylation status of tissue factor pathway inhibitor-2 gene in non-small-cell lung cancer.
15592528 2005 Epigenetic inactivation of TFPI-2 as a common mechanism associated with growth and invasion of pancreatic ductal adenocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467913 2004 Tissue factor pathway inhibitor-2 (TFPI-2) recognizes the complement and kininogen binding protein gC1qR/p33 (gC1qR): implications for vascular inflammation.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15221977 2004 Alterations in tumor necrosis factor-induced endothelial cell procoagulant activity by hyperthermia.
15183047 2004 Genetic variations in the human TFPI-2 gene and its promoter region by denaturing high performance liquid chromatography.
14983234 2004 Expression of tissue factor pathway inhibitor-2 in murine and human liver regulation during inflammation.
14970225 2004 Structure-function analysis of the reactive site in the first Kunitz-type domain of human tissue factor pathway inhibitor-2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14678821 2003 Computer model of the interaction of human TFPI-2 Kunitz-type serine protease inhibitor with human plasmin.
14623891 2004 Thrombin up-regulates tissue factor pathway inhibitor-2 synthesis through a cyclooxygenase-2-dependent, epidermal growth factor receptor-independent mechanism.
14558946 2003 [Role of tissue factor pathway inhibitor-2 in ovarian tumor migration and invasion].
14525759 2004 The effect of human tissue factor pathway inhibitor-2 on the growth and metastasis of fibrosarcoma tumors in athymic mice.
12921785 2003 Molecular cloning, expression, and characterization of bovine tissue factor pathway inhibitor-2.
12881707 2003 Promoter methylation and silencing of the tissue factor pathway inhibitor-2 (TFPI-2), a gene encoding an inhibitor of matrix metalloproteinases in human glioma cells.
12876637 2003 Immunohistochemical localization of tissue factor pathway inhibitor-2 in human tumor tissue.
12853948 2003 The DNA sequence of human chromosome 7.
12787920 2003 Human tissue factor pathway inhibitor-2 does not bind or inhibit activated matrix metalloproteinase-1.
12757776 2003 Characterization and functional analysis of TFPI-2 gene promoter in a human choriocarcinoma cell line.
12738994 2003 Physiological and chemical inducers of tissue factor pathway inhibitor-2 in human glioma cells.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12632077 2003 Methylation of TFPI-2 gene is not the sole cause of its silencing.
12606321 2003 Demonstration of a tissue factor pathway inhibitor 2 messenger RNA synthesis by pure villous cytotrophoblast cells isolated from term human placentas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11945080 Subcellular localization of PP5/TFPI-2 in human placenta: a possible role of PP5/TFPI-2 as an anti-coagulant on the surface of syncytiotrophoblasts.
11840337 2002 Minimal and inducible regulation of tissue factor pathway inhibitor-2 in human gliomas.
11834519 2002 Expression and localization of tissue factor pathway inhibitor-2 in normal and atherosclerotic human vessels.
11342222 2001 Genomic structure and promoter activity of the human tissue factor pathway inhibitor-2 gene.
10496984 1999 Matrix localization of tissue factor pathway inhibitor-2/matrix-associated serine protease inhibitor (TFPI-2/MSPI) involves arginine-mediated ionic interactions with heparin and dermatan sulfate: heparin accelerates the activity of TFPI-2/MSPI toward plasmin.
10026147 1999 Tissue factor pathway inhibitor-2 is a novel mitogen for vascular smooth muscle cells.
9548189 Specific expression of PP5/TFPI2 mRNA by syncytiotrophoblasts in human placenta as revealed by in situ hybridization.
9445254 1998 Quantification and characterization of human endothelial cell-derived tissue factor pathway inhibitor-2.
8945635 1996 Cloning of the cDNA encoding mouse PP5/TFPI-2 and mapping of the gene to chromosome 6.
8914837 1996 Extracellular matrix-associated serine protease inhibitors (Mr 33,000, 31,000, and 27,000) are single-gene products with differential glycosylation: cDNA cloning of the 33-kDa inhibitor reveals its identity to tissue factor pathway inhibitor-2.
8661135 1996 Assignment of the human PP5/TFPI-2 gene to 7q22 by FISH and PCR-based human/rodent cell hybrid mapping panel analysis.
8555184 1996 Inhibitory properties of a novel human Kunitz-type protease inhibitor homologous to tissue factor pathway inhibitor.
8159751 1994 Molecular cloning, expression, and partial characterization of a second human tissue-factor-pathway inhibitor.
7896752 1994 cDNA cloning and mRNA expression of a serine proteinase inhibitor secreted by cancer cells: identification as placental protein 5 and tissue factor pathway inhibitor-2.
7872799 1995 Novel extracellular matrix-associated serine proteinase inhibitors from human skin fibroblasts.
6884838 1983 Circulating levels of placental protein 5 in normal and abnormal pregnancies.
3276312 1988 Purification and characterization of placental protein 5.