Tbio | Tissue factor pathway inhibitor |
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016]
This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Activated Protein C Resistance | 3 | 0.0 | 0.0 |
Airway Obstruction | 3 | 0.0 | 0.0 |
Arthritis, Juvenile | 126 | 0.0 | 0.0 |
Hypoxia | 33 | 0.0 | 0.0 |
Purpura, Thrombotic Thrombocytopenic | 4 | 0.0 | 0.0 |
Venous Thrombosis | 47 | 0.0 | 0.0 |
Disease | Target Count |
---|---|
Juvenile arthritis | 126 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Cardiovascular system disease | 246 | 0.0 | 0.7 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Disseminated intravascular coagulation | 38 | 5.066 | 2.5 |
Cerebrovascular disease | 238 | 4.163 | 2.1 |
Coronary artery disease | 268 | 3.903 | 2.0 |
Atherosclerosis | 291 | 3.433 | 1.7 |
Cancer | 2499 | 3.363 | 1.7 |
Factor VII Deficiency | 7 | 3.003 | 1.5 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG |
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF 1 - 70 FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR 71 - 140 YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFE 141 - 210 FHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL 211 - 280 IKTKRKRKKQRVKIAYEEIFVKNM 281 - 304 //