Property Summary

NCBI Gene PubMed Count 68
PubMed Score 238.28
PubTator Score 139.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (48)

AA Sequence

MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF      1 - 70
HPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY                71 - 129
//

Text Mined References (68)

PMID Year Title