Property Summary

NCBI Gene PubMed Count 95
PubMed Score 262.66
PubTator Score 221.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.200 6.3e-03
oligodendroglioma 1.500 1.4e-03
osteosarcoma 1.187 6.7e-03
atypical teratoid / rhabdoid tumor -1.400 1.2e-05
glioblastoma 1.300 2.4e-02
medulloblastoma -1.500 1.0e-04
medulloblastoma, large-cell -2.500 1.2e-05
primitive neuroectodermal tumor -1.200 2.5e-03
primary pancreatic ductal adenocarcinoma 1.241 3.8e-03
aldosterone-producing adenoma -1.700 3.1e-02
COPD -1.100 1.7e-02
ductal carcinoma in situ -1.100 1.5e-03
invasive ductal carcinoma -1.200 5.9e-03
ovarian cancer -2.000 2.2e-10

Gene RIF (61)

PMID Text
26813791 TFEB and TFE3 are novel components of the integrated stress response
26636097 CT features including diameter, boundary, attenuation, nature, and circular calcification of the tumor, combined with demographic information and symptoms, may be useful to differentiate Xp11.2 RCC from different subtypes of PRCC.
26516944 Studies indicate that alveolar soft part sarcoma showed a specific chromosomal alteration, der(17)t(X:17)(p11:q25), resulting in the fusion of the TFE3 transcription factor gene (Xp11) with alveolar soft part sarcoma critical region 1 (ASPSCR1) at 17q25.
26415891 validates the utility of TFE3 break-apart fluorescence in situ hybridization on formalin-fixed paraffin-embedded tissue sections for diagnosis and confirmation of Xp11.2 translocation RCCs and alveolar soft part sarcoma
26274027 PSF/SFPQ is a very common gene fusion partner in TFE3 rearrangement-associated perivascular epithelioid cell tumors (PEComas) and melanotic Xp11 translocation renal cancers.
26045774 TMED6-COG8 chimera might act as a novel diagnostic marker in TFE3 translocation renal cell carcinoma.
25955396 Renal cell carcinoma (RCC) associated with Xp11.2 translocation/TFE3 gene fusion (Xp11.2 RCC) was introduced as a genetically distinct entity into the World Health Organization classification of renal neoplasms in 2004.
25714283 The purpose of this study was to compare the MDCT features of renal cell carcinoma (RCC) associated with Xp11.2 translocation and TFE3 gene fusion (Xp11 RCC) and papillary RCC
25551622 We report a case of RCC with Xp11.2 translocation in a 17 year old boy who is a survivor of stage 4 neuroblastoma 13 years earlier.
25517951 Report TFE3 translocation-associated perivascular epithelioid cell neoplasms of the gynecological tract.
25453902 A conditional expression in mice of the fusion gene ASPSCR1-TFE3 from human alveolar soft part sarcoma (ASPS) generated a model that recapitulates the human tumor histologically and by expression profile.
25399611 TFE3-GASE pathway is one of the regulatory pathways of the mammalian Golgi stress response
25337301 Case Report: PEComas of the cervix with TFE gene rearrangement.
25239799 study presents 3 cases of perivascular epithelioid cell tumor(PEComa) with TFE3 gene abnormalities; unusual cases of PEComa with TFE3 gene rearrangement might present malignant histological features and aggressive clinical behavior
25227872 Case Report: renal carcinoma associated with Xp11.2 translocations/ TFE3 gene fusions diagnosed using urine cytology.
25048860 Review of the role of gene fusions involving TFE3 and TFEB in carcinogenesis in sporadic renal cell carcinoma.
24726108 Xp11.2 translocation/TFE3 gene fusion renal cell carcinoma (RCC) is the predominant form of pediatric RCC, associated with advanced stage at presentation. Patients with N + M0 maintained a favorable prognosis following surgery alone.
24448649 overexpression of TFE3 triggered lysosomal exocytosis and resulted in cellular clearance in a cellular model of a lysosomal storage disorder, Pompe disease, thus identifying TFE3 as a potential therapeutic target for the treatment of lysosomal disorders
24339735 Expression in 16 TFE3 translocated.
24228124 Case Report: bilateral renal cell carcinoma in a patient undergoing long-term dialysis, which showed false-positive immunoreactivity for TFE3 immunostaining.
24136829 Typical Xp11-RCC manifests as an advanced, solid renal mass with mild persistent enhancement, a prevalence of intertumor hemorrhage/calcification, and a cortical epicenter location.
23828314 Report TFE3 rearrangement in Xp11.2 renal cell carcinoma and alveolar soft part sarcoma.
23737213 In summary, we are reporting a novel subset of EHE occurring in young adults, showing a distinct phenotype and YAP1-TFE3 fusions.
23715164 TFE3 FISH is highly useful in renal tumor consultation material, often resolving cases with equivocal TFE3 immunohistochemistry results.
23711163 cutaneous PEComas consistently lack TFE3 expression
23598965 Our results support the clinical application of a TFE3 break-apart FISH assay for diagnosis and confirmation of Xp11.2 Renal cell carcinoma
23288701 Results support a gain-of-function role for ASPSCR1-TFE3 contributing to proliferation and survival of cancer cells.
23192203 Renal cell carcinoma associated with Xp11.2 translocation is characterized by at least 6 different chromosomal translocations that all result in gene fusion of the TFE3 transcription factor present at Xp11.2.
22995920 TFE3 translocation is associated with relapsed metastatic renal cell carcinoma.
22498819 Results suggest that adult renal cell carcinoma with TFE3 rearrangement may be a clinically aggressive tumor.
22456611 Perivascular epithelioid cell tumors with TFE3 gene fusions demonstrated intact, robust tuberin protein labeling and no TSC2 loss of heterozygosity.
22446944 Describes the clinical and histopathologic features of TFE3 and TFEB translocation renal cell carcinoma.
22297304 The potential role of TFE3 in regulating metabolic genes and glucose metabolism within skeletal muscle suggests that it may be used for treating metabolic diseases
22207547 fusion of the TFE3 gene with several different genes, including ASPL(17q25), PRCC(1q21), PSF(1q34), NonO (Xq12) and CLTC (17q23) have been identified to date[review]
22173238 TFE3 is a useful immunohistochemical marker for diagnosis of an alveolar soft part sarcoma.
22037260 TFE3 overexpressing tumours show an aggressive behaviour and Xp11 translocation is only one of several possible underlying genomic alterations.
21835426 In alveolar soft part sarcomas with unusual locations or histology, we consider that the detection of the ASPSCR1-TFE3 fusion transcript would be the highly effective diagnostic technique.
21602817 Demonstrate here the differential expression of cathepsin K among neoplasms harboring TFE3 gene fusions.
21555518 TFE3 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
21299348 Report variable expression of TFE3 in different variants of renal cell carcinoma.
21279521 Immuno-detection of TFE3 and RT-PCR-based identification of ASPL/TFE3 fusion transcripts are powerful tools in the diagnosis of alveolar soft part sarcoma.
21070573 TFE3-positive renal cell carcinoma occurs in adults, is more aggressive, and presents at a higher clinical stage than in paediatric cases.
20871214 In conclusion, a subset of lesions currently classified as PEComas harbors TFE3 gene fusions.
20620589 A novel case of t(X;1)(p11.2;p34) in a renal cell carcinoma with TFE3 rearrangement and favorable outcome in a 57-year-old patient.
20014561 The immunocytochemistry of TFE3 protein may be a powerful tool for accurate diagnosis when renal cell carcinoma associated with Xp11.2 translocation/TFE3 gene fusion is suspected.
19809274 Melanotic Xp11 translocation renal cancer: a case with PSF-TFE3 gene fusion and up-regulation of melanogenetic transcripts.
19788626 The first case of nasal perivascular epithelioid cell tumor (PEComa) showing TFE3 protein is reported.
19422821 Our data suggest a scenario in which, during the course of renal cell carcinoma development, an initial PRCCTFE3-induced cell cycle delay must be numbed, thus permitting continued proliferation and progression towards full-blown malignancy.
19396149 overexpression of TFE3 or TFEB in renal cell carinomas activates the expression of genes normally regulated by microphthalmia transcription factor in other cell types.
19332055 identified a Tfe3-binding site (EBox) in the MAFB promoter region
18510571 May have a role in the etiology of perivascular epithelioid cell tumors.
18278810 Translocation involving the TFE3 gene is associated with renal cell carcinoma.
18187620 Knockdown of transcription factor binding to IGHM enhancer 3 (TFE3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18176180 Immunohistochemical discrimination between the ASPL-TFE3 fusion proteins of alveolar soft part sarcoma
17905124 A renal cell carcinoma was associated with TFE3 overexpression (related to TFE3 gene fusion). The genetic abnormality in this case was likely an ASPL-TFE3 translocation.
17046750 Tfe3 is able to induce mono-macrophagic differentiation of U937 cells, in association with a decrease of cell proliferation and an increase of apoptosis. Also Tfe3 does not act physiologically during commitment of CD34+ hematopoietic stem cells (HSCs).
16766266 MITF and TFE3 reciprocally rescue one another in lines derived from CCS or pediatric renal carcinoma.
16737956 role for endogenous TFE3 in the direct regulation of CYCLIN E expression in an E2F3-dependent manner
15782069 this is the first report of ASPS of the female genital tract with immunoreactivity for TFE3
15747097 Many cases of RCC in children reported under the terms "papillary" and "clear cell" likely represent Xp11.2 translocation/TFE3 gene fusion-associated RCC.
12748276 Data suggest that the physical interaction of TFE3 and E2F3 facilitates transcriptional activation of the p68 gene and provides strong evidence for the specificity of E2F function.

AA Sequence

MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQ      1 - 70
PLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAA     71 - 140
PFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPK    141 - 210
LASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEML    211 - 280
SYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDN    281 - 350
HNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN    351 - 420
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQ    421 - 490
QPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAASDPLLSSVSPAVS    491 - 560
KASSRRSSFSMEEES                                                           561 - 575
//

Text Mined References (103)

PMID Year Title
26813791 2016 TFEB and TFE3 are novel components of the integrated stress response.
26636097 2015 Dynamic Contrast-Enhanced CT Characterization of Xp11.2 Translocation/TFE3 Gene Fusions versus Papillary Renal Cell Carcinomas.
26516944 2015 Alveolar Soft Part Sarcoma.
26415891 2015 Validation and utilization of a TFE3 break-apart FISH assay for Xp11.2 translocation renal cell carcinoma and alveolar soft part sarcoma.
26274027 2015 PSF/SFPQ is a very common gene fusion partner in TFE3 rearrangement-associated perivascular epithelioid cell tumors (PEComas) and melanotic Xp11 translocation renal cancers: clinicopathologic, immunohistochemical, and molecular characteristics suggesting classification as a distinct entity.
26045774 2015 TMED6-COG8 is a novel molecular marker of TFE3 translocation renal cell carcinoma.
25955396 Dynamic Computed Tomographic Features of Adult Renal Cell Carcinoma Associated With Xp11.2 Translocation/TFE3 Gene Fusions: Comparison With Clear Cell Renal Cell Carcinoma.
25714283 2015 MDCT findings of renal cell carcinoma associated with Xp11.2 translocation and TFE3 gene fusion and papillary renal cell carcinoma.
25551622 2015 Renal cell carcinoma with Xp 11.2 translocation as a second tumor in a long-term survivor of advanced neuroblastoma.
25517951 2015 TFE3 translocation-associated perivascular epithelioid cell neoplasm (PEComa) of the gynecologic tract: morphology, immunophenotype, differential diagnosis.
25453902 2014 Modeling alveolar soft part sarcomagenesis in the mouse: a role for lactate in the tumor microenvironment.
25399611 2015 TFE3 is a bHLH-ZIP-type transcription factor that regulates the mammalian Golgi stress response.
25337301 2014 Malignant perivascular epithelioid cell tumor (PEComa) of cervix with TFE3 gene rearrangement: a case report.
25239799 2014 Perivascular epithelioid cell tumor (PEComa) with TFE3 gene rearrangement: clinicopathological, immunohistochemical, and molecular features.
25227872 2014 Cytologic Features of Renal Carcinoma Associated with Xp11.2 Translocations/ TFE3 Gene Fusions: A Case Report with Voided and Catheterized Urine Cytology and a Literature Review.
25048860 2014 Molecular genetics and cellular features of TFE3 and TFEB fusion kidney cancers.
24726108 2014 Biological characteristics of pediatric renal cell carcinoma associated with Xp11.2 translocations/TFE3 gene fusions.
24448649 2014 The nutrient-responsive transcription factor TFE3 promotes autophagy, lysosomal biogenesis, and clearance of cellular debris.
24339735 2013 Identification of molecular tumor markers in renal cell carcinomas with TFE3 protein expression by RNA sequencing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24228124 2013 A case of bilateral renal cell carcinoma associated with long-term dialysis showing false-positive immunoreactivity for TFE3 as Xp11 translocation renal cell carcinoma.
24136829 2014 Renal carcinomas associated with Xp11.2 translocations/TFE3 gene fusions: findings on MRI and computed tomography imaging.
23828314 2014 Molecular cytogenetic analysis for TFE3 rearrangement in Xp11.2 renal cell carcinoma and alveolar soft part sarcoma: validation and clinical experience with 75 cases.
23737213 2013 Novel YAP1-TFE3 fusion defines a distinct subset of epithelioid hemangioendothelioma.
23715164 2013 Utilization of a TFE3 break-apart FISH assay in a renal tumor consultation service.
23711163 2013 Cutaneous PEComa does not harbour TFE3 gene fusions: immunohistochemical and molecular study of 17 cases.
23598965 2013 TFE3 break-apart FISH has a higher sensitivity for Xp11.2 translocation-associated renal cell carcinoma compared with TFE3 or cathepsin K immunohistochemical staining alone: expanding the morphologic spectrum.
23451753 2013 Transcription factor E3 protein-positive perivascular epithelioid cell tumor of the appendix presenting as acute appendicitis: a case report and review of the literature.
23288701 2013 Combining integrated genomics and functional genomics to dissect the biology of a cancer-associated, aberrant transcription factor, the ASPSCR1-TFE3 fusion oncoprotein.
23192203 Computed tomography and magnetic resonance imaging of adult renal cell carcinoma associated with Xp11.2 translocation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22995920 2013 Persistent complete response after single-agent sunitinib treatment in a case of TFE translocation positive relapsed metastatic pediatric renal cell carcinoma.
22498819 2012 TFE3 rearrangements in adult renal cell carcinoma: clinical and pathologic features with outcome in a large series of consecutively treated patients.
22456611 2012 Perivascular epithelioid cell tumors (PEComas) harboring TFE3 gene rearrangements lack the TSC2 alterations characteristic of conventional PEComas: further evidence for a biological distinction.
22446944 2012 Translocation renal cell carcinomas in adults: a single-institution experience.
22297304 2012 TFE3 regulates muscle metabolic gene expression, increases glycogen stores, and enhances insulin sensitivity in mice.
22207547 2012 Review of renal carcinoma associated with Xp11.2 translocations/TFE3 gene fusions with focus on pathobiological aspect.
22173238 2012 Alveolar soft part sarcoma 'revisited': clinicopathological review of 47 cases from a tertiary cancer referral centre, including immunohistochemical expression of TFE3 in 22 cases and 21 other tumours.
22037260 2012 Molecular heterogeneity of TFE3 activation in renal cell carcinomas.
21835426 2012 Technique for differentiating alveolar soft part sarcoma from other tumors in paraffin-embedded tissue: comparison of immunohistochemistry for TFE3 and CD147 and of reverse transcription polymerase chain reaction for ASPSCR1-TFE3 fusion transcript.
21602817 2011 Differential expression of cathepsin K in neoplasms harboring TFE3 gene fusions.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21299348 2011 The expression pattern of Von Hippel-Lindau tumor suppressor protein, MET proto-oncogene, and TFE3 transcription factor oncoprotein in renal cell carcinoma in Upper Egypt.
21279521 2011 Detection of ASPL/TFE3 fusion transcripts and the TFE3 antigen in formalin-fixed, paraffin-embedded tissue in a series of 18 cases of alveolar soft part sarcoma: useful diagnostic tools in cases with unusual histological features.
21209915 2010 Inactivation of the FLCN tumor suppressor gene induces TFE3 transcriptional activity by increasing its nuclear localization.
21070573 2011 Altered transcription factor E3 expression in unclassified adult renal cell carcinoma indicates adverse pathological features and poor outcome.
20871214 2010 A distinctive subset of PEComas harbors TFE3 gene fusions.
20620589 2010 A novel case of t(X;1)(p11.2;p34) in a renal cell carcinoma with TFE3 rearrangement and favorable outcome in a 57-year-old patient.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20014561 Imprint cytologic features in renal cell carcinoma associated with Xp11.2 translocation/TFE3 gene fusion in an adult: a case report.
19809274 2009 Melanotic Xp11 translocation renal cancer: a case with PSF-TFE3 gene fusion and up-regulation of melanogenetic transcripts.
19788626 2009 Perivascular epithelioid cell tumor of the nasal cavity with TFE3 expression.
19422821 2009 The renal cell carcinoma-associated oncogenic fusion protein PRCCTFE3 provokes p21 WAF1/CIP1-mediated cell cycle delay.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19396149 2009 Cathepsin-K immunoreactivity distinguishes MiTF/TFE family renal translocation carcinomas from other renal carcinomas.
19332055 2009 TFE3 transcription factor regulates the expression of MAFB during macrophage differentiation.
18930356 2009 TFE3-renal carcinoma in an adult patient: a case with strong expression of phosphorylated hepatocyte growth factor (HGFR)/Met.
18510571 2008 The role of TFE3 in PEComa.
18358634 2008 Overexpression of cyclin D1, D3, and p21 in an infantile renal carcinoma with Xp11.2 TFE3-gene fusion.
18278810 2008 Translocation renal cell carcinoma: lack of negative impact due to lymph node spread.
18176180 2008 Immunohistochemical discrimination between the ASPL-TFE3 fusion proteins of alveolar soft part sarcoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17905124 2007 Renal cell carcinoma associated with TFE3 gene fusion in an elderly woman.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17046750 2006 Tfe3 expression is closely associated to macrophage terminal differentiation of human hematopoietic myeloid precursors.
16766266 2006 Oncogenic MITF dysregulation in clear cell sarcoma: defining the MiT family of human cancers.
16737956 2006 A functional genetic screen identifies TFE3 as a gene that confers resistance to the anti-proliferative effects of the retinoblastoma protein and transforming growth factor-beta.
16327801 2006 TFE3 transcriptionally activates hepatic IRS-2, participates in insulin signaling and ameliorates diabetes.
15782069 2005 TFE3 immunoreactivity in alveolar soft part sarcoma of the uterine cervix: case report.
15772651 2005 The DNA sequence of the human X chromosome.
15747097 Pediatric renal carcinoma associated with Xp11.2 translocations/TFE3 gene fusions and clinicopathologic associations.
15507434 2005 Sumoylation of MITF and its related family members TFE3 and TFEB.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
12917640 2003 A novel CLTC-TFE3 gene fusion in pediatric renal adenocarcinoma with t(X;17)(p11.2;q23).
12748276 2003 Identification of E-box factor TFE3 as a functional partner for the E2F3 transcription factor.
12551947 2003 Both Max and TFE3 cooperate with Smad proteins to bind the plasminogen activator inhibitor-1 promoter, but they have opposite effects on transcriptional activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11930005 2002 Mitf and Tfe3, two members of the Mitf-Tfe family of bHLH-Zip transcription factors, have important but functionally redundant roles in osteoclast development.
11801598 2002 bcn-1 Element-dependent activation of the laminin gamma 1 chain gene by the cooperative action of transcription factor E3 (TFE3) and Smad proteins.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11467950 2001 TFEC can function as a transcriptional activator of the nonmuscle myosin II heavy chain-A gene in transfected cells.
11358836 2001 Fusion of a novel gene, RCC17, to the TFE3 gene in t(X;17)(p11.2;q25.3)-bearing papillary renal cell carcinomas.
11313885 2001 Transformation capacities of the papillary renal cell carcinoma-associated PRCCTFE3 and TFE3PRCC fusion genes.
11244503 2001 The der(17)t(X;17)(p11;q25) of human alveolar soft part sarcoma fuses the TFE3 transcription factor gene to ASPL, a novel gene at 17q25.
10973944 2000 Synergism between transcription factors TFE3 and Smad3 in transforming growth factor-beta-induced transcription of the Smad7 gene.
10644981 2000 Nuclear localization and transactivating capacities of the papillary renal cell carcinoma-associated TFE3 and PRCC (fusion) proteins.
10557285 1999 Specificity in transforming growth factor beta-induced transcription of the plasminogen activator inhibitor-1 gene: interactions of promoter DNA, transcription factor muE3, and Smad proteins.
10506710 1999 Chromosome rearrangement at 17q25 and xp11.2 in alveolar soft-part sarcoma: A case report and review of the literature.
9806910 1998 The bHLH-Zip transcription factor Tfeb is essential for placental vascularization.
9765209 1998 Synergistic cooperation of TFE3 and smad proteins in TGF-beta-induced transcription of the plasminogen activator inhibitor-1 gene.
9393982 1997 Fusion of splicing factor genes PSF and NonO (p54nrb) to the TFE3 gene in papillary renal cell carcinoma.
8986805 1996 Fusion of the transcription factor TFE3 gene to a novel gene, PRCC, in t(X;1)(p11;q21)-positive papillary renal cell carcinomas.
8872474 1996 The t(X;1)(p11.2;q21.2) translocation in papillary renal cell carcinoma fuses a novel gene PRCC to the TFE3 transcription factor gene.
8336698 1993 TFEC, a basic helix-loop-helix protein, forms heterodimers with TFE3 and inhibits TFE3-dependent transcription activation.
7587394 1995 Mapping the X chromosome breakpoint in two papillary renal cell carcinoma cell lines with a t(X;1)(p11.2;q21.2) and the first report of a female case.
7490085 1995 The genomic organization of the human transcription factor 3 (TFE3) gene.
2338243 1990 TFE3: a helix-loop-helix protein that activates transcription through the immunoglobulin enhancer muE3 motif.
2044953 1991 The leucine zipper of TFE3 dictates helix-loop-helix dimerization specificity.
1685140 1991 The gene encoding human TFE3, a transcription factor that binds the immunoglobulin heavy-chain enhancer, maps to Xp11.22.
1672758 1991 A high-frequency RFLP at the human TFE3 locus on the X chromosome.