Property Summary

NCBI Gene PubMed Count 28
PubMed Score 4.35
PubTator Score 66.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.500 7.2e-04
osteosarcoma -2.998 1.2e-05
sonic hedgehog group medulloblastoma 2.100 7.9e-08
atypical teratoid / rhabdoid tumor 1.500 6.6e-04
glioblastoma 1.200 6.4e-03
primitive neuroectodermal tumor 1.200 2.5e-02
Atopic dermatitis -1.100 3.8e-04
non-small cell lung cancer 1.683 8.5e-19
lung cancer 1.900 3.8e-03
invasive ductal carcinoma -1.400 1.6e-02
Pick disease 1.300 2.6e-05
ovarian cancer -1.400 6.7e-08
cystic fibrosis and chronic rhinosinusit... 1.356 3.5e-02

Protein-protein Interaction (13)

Gene RIF (6)

PMID Text
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
25312757 DP2 is expressed by the bronchial epithelium, and its activation drives epithelial differentiation, suggesting that in addition to its well-characterized role in inflammatory cell migration, DP2 might contribute to airway remodeling in asthmatic patients.
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of transcription factor Dp-2 (E2F dimerization partner 2; TFDP2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
8755520 This study demonstrates translation from an internal methionine.

AA Sequence

MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGPQMIISTPQRL      1 - 70
TSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESKRSKKGDKNGKGLRHFSMKVC     71 - 140
EKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLP    141 - 210
TNSAQECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIIN    211 - 280
TSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYIT    281 - 350
DISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS    351 - 420
ESRGETPCSFNDEDEEDDEEDSSSPE                                                421 - 446
//

Text Mined References (35)

PMID Year Title
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
25416956 2014 A proteome-scale map of the human interactome network.
25312757 2015 D prostanoid receptor 2 (chemoattractant receptor-homologous molecule expressed on TH2 cells) protein expression in asthmatic patients and its effects on bronchial epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810586 2012 Interpreting cancer genomes using systematic host network perturbations by tumour virus proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20176812 2010 Repression of transcriptional activity of C/EBPalpha by E2F-dimerization partner complexes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18316326 2008 Exploration of human ORFeome: high-throughput preparation of ORF clones and efficient characterization of their protein products.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16360038 2005 Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16061792 2005 Association of the human papillomavirus type 16 E7 oncoprotein with the 600-kDa retinoblastoma protein-associated factor, p600.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12927774 2003 Inhibitory effects of novel E2F decoy oligodeoxynucleotides on mesangial cell proliferation by coexpression of E2F/DP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036888 2002 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.
10090723 1999 Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
9689056 1998 Unusual proliferation arrest and transcriptional control properties of a newly discovered E2F family member, E2F-6.
9501179 1998 E2F-6, a member of the E2F family that can behave as a transcriptional repressor.
9368098 1997 Molecular cloning and expression pattern of the DP members of the chicken E2F transcription factor.
9027491 1997 Genomic cloning and chromosomal assignment of the E2F dimerization partner TFDP gene family.
8755520 1996 DP-2, a heterodimeric partner of E2F: identification and characterization of DP-2 proteins expressed in vivo.
7784053 1995 Cloning and characterization of human DP2, a novel dimerization partner of E2F.
7739537 1995 In vivo association of E2F and DP family proteins.