Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.38
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -2.100 1.2e-07
cystic fibrosis -1.700 1.0e-04
group 3 medulloblastoma -1.500 1.0e-02
interstitial cystitis -1.700 3.9e-04
intraductal papillary-mucinous adenoma (... 1.900 7.8e-04
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
lung cancer -2.200 1.2e-02
lung carcinoma -1.200 2.1e-06
osteosarcoma 1.661 1.8e-07
pancreatic ductal adenocarcinoma liver m... 1.114 2.7e-02
posterior fossa group A ependymoma 1.200 2.1e-03
primary Sjogren syndrome -1.400 2.2e-02
psoriasis -1.900 1.9e-03
ulcerative colitis -1.300 3.3e-03

Gene RIF (3)

AA Sequence

MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYLN      1 - 70
QGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGI     71 - 140
LDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHS    141 - 210
ASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPN    211 - 280
SFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQIC    281 - 350
GPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIAN    351 - 420
LYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL               421 - 479
//

Text Mined References (13)

PMID Year Title