Property Summary

NCBI Gene PubMed Count 60
PubMed Score 72.74
PubTator Score 54.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.368 8.0e-03
atypical teratoid / rhabdoid tumor 1.300 1.6e-02
Breast cancer 1.500 1.8e-02
colon cancer -2.900 3.4e-03
cutaneous lupus erythematosus -1.600 2.2e-02
facioscapulohumeral dystrophy 3.900 9.2e-10
interstitial cystitis -1.400 1.2e-02
lung cancer -4.800 4.7e-06
malignant mesothelioma 4.300 2.5e-08
non-small cell lung cancer 1.596 7.0e-15
ovarian cancer 1.800 1.3e-03
psoriasis -1.100 1.3e-03
ulcerative colitis 1.500 8.6e-06

Gene RIF (38)

AA Sequence

MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQLAYS      1 - 70
QSADPYSHLGEAYAAAINPLHQPAPTGSQQQAWPGRQSQEGAGLPSHHGRPAGLLPHLSGLEAGAVSARR     71 - 140
DAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQ    141 - 210
KELVGAVMNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRE    211 - 280
KLDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKN    281 - 350
MLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEAL    351 - 420
IVIDKSYMNPGDQSPADSNKTLEKMEKHRK                                            421 - 450
//

Text Mined References (65)

PMID Year Title