Property Summary

NCBI Gene PubMed Count 71
PubMed Score 50.11
PubTator Score 73.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.300 1.6e-05
cutaneous lupus erythematosus -2.400 6.1e-03
fibroadenoma 2.200 4.1e-02
posterior fossa group A ependymoma -1.200 4.2e-04
non primary Sjogren syndrome sicca 1.200 2.0e-02
inflammatory breast cancer -3.000 1.9e-02
ductal carcinoma in situ 4.300 5.0e-04

 GO Component (1)

Gene RIF (52)

PMID Text
26598443 results suggest that TFAP2B is playing a vital role in retaining retinoic acid responsiveness and mediating noradrenergic neuronal differentiation in neuroblastoma.
26189251 The expression of TFAP-2beta mRNA in tissue of patients with endometrial carcinoma was higher than that of normal endometrium. The expression of TFAP-2beta mRNA in endometrial tissue of patients with metabolism syndrome was higher than that of lean ones.
24766673 TFAP2B overexpression contributes to tumor growth and a poor prognosis of human lung adenocarcinoma through modulation of ERK and VEGF/PEDF signaling.
24507797 A haploinsufficiency effect of TFAP2B could be involved in familial isolated patent ductus arteriosus.
24081236 TFAP2B rs987237 and dietary protein/carbohydrate interacted to modify weight maintenance.
23881096 The AP-2beta polymorphism significantly influenced cognitive performance, whereas the MAOA and COMT polymorphisms did not.
23824473 The presence of the nine-repeat variant of the TFAP-2beta intron 1 VNTR appears to protect girls with ADHD symptoms from the co-expression of symptoms of depression.
22959235 genomic GATA4 and TFAP2B missense mutations may be associated with nonfamilial congenital heart disease with diverse clinical phenotypes in patients with congenital heart disease from southern China
22952648 Under energy restriction, TFAP2B may modify the effect of dietary fat intake on weight loss and waist reduction
22199100 The findings suggest the lack of involvement of known mutations of TFAP2B with syndromic or nonsyndromic CHDs in Mysore patients
21766608 It causes accumulation of neutral fats and causes insulin resistance through exaggerated glucose uptake independent of insulin and induces abnormal adipokine secretion, fat cell enlargement and insulin resistance.
21674055 central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B
21643846 TFAP2B mutation should be considered a risk factor for isolated PDA. However, the detailed genetic mechanism underlying nonsyndromic the PDA-causing TFAP2B mutation is yet to be elucidated.
21504541 This study supports a role of the SLC6A4, DRD4 and TFAP2B genes in the temperament, including a gene-gene interaction between SLC6A4 and TFAP2B. It also provides evidence about an effect of the TFAP2B polymorphism in TFAP2B gene transcription.
21215182 A novel splice-junction in TFAP-2B gene might lead to hereditary patent ductus arteriosus in a Chinese family.
20724581 Observational study of gene-disease association. (HuGE Navigator)
20703240 Observational study of gene-disease association. (HuGE Navigator)
20607706 Loss of TFAP2B is associated with retinoblastoma.
20019683 TFAP2B seems to regulate the expression of various adipokines in vivo
19778525 The present study identifies TFAP2b as a suggestive candidate gene in alcohol dependence.
19557161 TFAP2B, LYPLAL1 and MSRA are associated with adiposity and fat distribution.
19557161 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19325541 Reduction of TFAP2B expression could have a protective effect against future risk of complications associated with decreased insulin sensitivity and central adiposity, such as type 2 diabetes and coronary heart disease.
19325541 Observational study of gene-disease association. (HuGE Navigator)
19184334 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18752453 Novel TFAP2B mutation in nonsyndromic patent ductus arteriosus is reported.
18358611 a potential usefulness of AP-2beta polymorphisms in explaining or predicting central nervous diseases, drug effects and side effects.
18358611 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17728669 Observational study of gene-disease association. (HuGE Navigator)
17630431 activating enhancer-binding protein-2beta (AP-2beta) as a novel transcription factor that specifically binds to and activates the hTERT promoter in human lung cancer cells.
17574780 L-PGDS gene expression in TE671 cells was activated by USF1 through the aE-box within intron 4 and cooperatively by AP-2beta in the promoter in a cell-type-specific manner.
17525748 TFAP2B was validated as direct target gene mediating the anti-apoptotic function of PAX3/FKHR
17185054 Investigators speculate on the possible role of TFAP2B gene on the duplicated segment in the three reported cases of partial trisomy.
17123722 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17123722 Boys and girls with the combination of presence of the short 5-HTTLPR, and homozygosity for the long AP-2beta genotype scored significantly lower on Self-Transcendence and Spiritual Acceptance.
16954217 AP-2beta directly inhibits adiponectin gene expression by displacing NF-YA and binding to its promoter.
16787706 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16373396 TFAP2B may contribute to the pathogenesis of type 2 diabetes through regulation of adipocytokine gene expression, and that TFAP2B may be a promising target for treatment or prevention of this disease.
15940393 Observational study of gene-disease association. (HuGE Navigator)
15940393 Genetic variations in the gene encoding TFAP2B are associated with type 2 diabetes mellitus.
15722186 Observational study of gene-disease association. (HuGE Navigator)
15722186 No differences are observed in AP-2 beta genotype frequencies between 176 subjects with premenstrual dysphoric disorder (PMDD) and 91 healthy controls.
15569994 Expression of MMP-2 and MMP-9 in breast cancer seems to be partly related to expression of AP-2 and HER2
15245963 AP-2beta expression was observed in the low-stage subtypes of renal cell carcinoma, and this transcription factor may be related to early carcinogenesis.
15057523 Observational study of gene-disease association. (HuGE Navigator)
15057523 No association between the AP-2beta genotype and measures of dopamine receptor density, or CSF 5-HIAA concentrations.
14673213 Observational study of gene-disease association. (HuGE Navigator)
14673213 AP-2beta intron 2 genotype is associated with low levels of anxiety-related personality traits in women.
12270648 no association between a transcription factor Activating Protein 2beta (AP-2beta) gene variant and schizophrenia
12228234 AP2 regulates human reduced folate carrier gene expression
11505339 Novel TFAP2B mutations causing Char syndrome have a dominant-negative effect and provide a genotype-phenotype correlation.

AA Sequence

MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYF      1 - 70
PPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRD     71 - 140
YHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTS    141 - 210
LMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNG    211 - 280
GRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDL    281 - 350
HSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNY    351 - 420
LTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK                                  421 - 460
//

Text Mined References (70)

PMID Year Title
26598443 2016 Transcription factor activating protein 2 beta (TFAP2B) mediates noradrenergic neuronal differentiation in neuroblastoma.
26189251 2015 Correlation between transcription factor activator protein-2? (TFAP-2?) and endometrial carcinoma.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24766673 2014 TFAP2B overexpression contributes to tumor growth and a poor prognosis of human lung adenocarcinoma through modulation of ERK and VEGF/PEDF signaling.
24507797 2014 Characterization of transcription factor AP-2 ? mutations involved in familial isolated patent ductus arteriosus suggests haploinsufficiency.
24081236 2013 TFAP2B -dietary protein and glycemic index interactions and weight maintenance after weight loss in the DiOGenes trial.
23881096 2013 Neuropsychological correlates of transcription factor AP-2Beta, and its interaction with COMT and MAOA in healthy females.
23824473 2014 Transcription Factor Activating Protein-2? (TFAP-2?) genotype and symptoms of attention deficit hyperactivity disorder in relation to symptoms of depression in two independent samples.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22959235 Analyses of GATA4, NKX2.5, and TFAP2B genes in subjects from southern China with sporadic congenital heart disease.
22952648 2012 TFAP2B influences the effect of dietary fat on weight loss under energy restriction.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22199100 2011 Mutations of TFAP2B in congenital heart disease patients in Mysore, South India.
21935397 2011 Genome-wide population-based association study of extremely overweight young adults--the GOYA study.
21766608 2011 [Role of TFAP2B and WntSB in adipose tissue].
21674055 2011 Implications of central obesity-related variants in LYPLAL1, NRXN3, MSRA, and TFAP2B on quantitative metabolic traits in adult Danes.
21643846 2011 Familial nonsyndromic patent ductus arteriosus caused by mutations in TFAP2B.
21504541 2011 Association between neonatal temperament, SLC6A4, DRD4 and a functional polymorphism located in TFAP2B.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21215182 2010 [Mutation of TFAP-2B gene in patients with patent ductus arteriosus].
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20703240 2010 Polymorphisms in NRXN3, TFAP2B, MSRA, LYPLAL1, FTO and MC4R and their effect on visceral fat area in the Japanese population.
20607706 2010 AP2 transcription factor induces apoptosis in retinoblastoma cells.
20019683 2010 Relation of the expression of transcriptional factor TFAP2B to that of adipokines in subcutaneous and omental adipose tissues.
19778525 2009 Transcription factor AP2 beta involved in severe female alcoholism.
19557161 2009 Genome-wide association scan meta-analysis identifies three Loci influencing adiposity and fat distribution.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19325541 2009 The transcription factor TFAP2B is associated with insulin resistance and adiposity in healthy adolescents.
19184334 2009 Transcription factor AP-2 beta genotype and psychosocial adversity in relation to adolescent depressive symptomatology.
19115315 2009 The interaction of KCTD1 with transcription factor AP-2alpha inhibits its transactivation.
18752453 2008 Novel TFAP2B mutation in nonsyndromic patent ductus arteriosus.
18358611 2008 Electrophysiological and behavioral correlates of polymorphisms in the transcription factor AP-2beta coding gene.
17728669 2007 Association analysis of 15 polymorphisms within 10 candidate genes for antisocial behavioural traits.
17630431 2007 Tumor-specific activation of human telomerase reverses transcriptase promoter activity by activating enhancer-binding protein-2beta in human lung cancer cells.
17574780 2007 Cooperative activation of lipocalin-type prostaglandin D synthase gene expression by activator protein-2beta in proximal promoter and upstream stimulatory factor 1 within intron 4 in human brain-derived TE671 cells.
17525748 2007 Comparative expression profiling identifies an in vivo target gene signature with TFAP2B as a mediator of the survival function of PAX3/FKHR.
17185054 Pure partial trisomy of 6p12.1-p22.1 secondary to a familial 12/6 insertion in two malformed babies.
17123722 2007 Genes encoding for AP-2beta and the Serotonin Transporter are associated with the Personality Character Spiritual Acceptance.
16954217 2006 Transcription factor activating enhancer-binding protein-2beta. A negative regulator of adiponectin gene expression.
16787706 2006 Association study of the INPP1, 5HTT, BDNF, AP-2beta and GSK-3beta GENE variants and restrospectively scored response to lithium prophylaxis in bipolar disorder.
16420676 2005 The AP-2 family of transcription factors.
16373396 2006 Intronic polymorphisms within TFAP2B regulate transcriptional activity and affect adipocytokine gene expression in differentiated adipocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15940393 2005 Genetic variations in the gene encoding TFAP2B are associated with type 2 diabetes mellitus.
15722186 2005 Investigation of transcription factor AP-2 beta genotype in women with premenstrual dysphoric disorder.
15569994 2004 Expression of matrix metalloproteinase (MMP)-2 and MMP-9 in breast cancer with a special reference to activator protein-2, HER2, and prognosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15245963 2004 Differential expression of activator protein-2 isoforms in renal cell carcinoma.
15057523 2004 Transcription factor AP-2beta genotype, striatal dopamine D2 receptor density and cerebrospinal fluid monoamine metabolite concentrations in humans.
14673213 2003 Transcription factor AP-2beta genotype associated with anxiety-related personality traits in women. A replication study.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12586840 2003 Physical and functional interactions among AP-2 transcription factors, p300/CREB-binding protein, and CITED2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270648 2002 No association between a transcription factor Activating Protein 2beta (AP-2beta) gene variant and schizophrenia.
12228234 2002 The human reduced folate carrier gene is regulated by the AP2 and sp1 transcription factor families and a functional 61-base pair polymorphism.
12192491 2002 Different properties of three isoforms (alpha, beta, and gamma) of transcription factor AP-2 in the expression of human keratinocyte genes.
12169688 2002 The role of Sp1 and AP-2 in basal and protein kinase A--induced expression of mitochondrial serine:pyruvate aminotransferase in hepatocytes.
12072434 2002 Transcription factor AP-2 interacts with the SUMO-conjugating enzyme UBC9 and is sumolated in vivo.
11744733 2002 Human CREB-binding protein/p300-interacting transactivator with ED-rich tail (CITED) 4, a new member of the CITED family, functions as a co-activator for transcription factor AP-2.
11694877 2001 Cardiac malformations, adrenal agenesis, neural crest defects and exencephaly in mice lacking Cited2, a new Tfap2 co-activator.
11505339 2001 Novel TFAP2B mutations that cause Char syndrome provide a genotype-phenotype correlation.
11278660 2001 Transcription factor AP-2 functions as a repressor that contributes to the liver-specific expression of serum amyloid A1 gene.
10802654 2000 Mutations in TFAP2B cause Char syndrome, a familial form of patent ductus arteriosus.
9271117 1997 Enhanced apoptotic cell death of renal epithelial cells in mice lacking transcription factor AP-2beta.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8661133 1996 Chromosomal mapping of the human and mouse homologues of two new members of the AP-2 family of transcription factors.
7729426 1995 Transcriptional activation by Myc is under negative control by the transcription factor AP-2.
7559606 1995 Transcription factor AP-2 regulates human insulin-like growth factor binding protein-5 gene expression.
7555706 1995 Cloning and characterization of a second AP-2 transcription factor: AP-2 beta.