Property Summary

NCBI Gene PubMed Count 134
PubMed Score 457.70
PubTator Score 351.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.7e-02
Multiple myeloma 1.474 4.7e-03
malignant mesothelioma 1.500 2.3e-06
osteosarcoma -1.688 4.7e-04
group 4 medulloblastoma 2.300 9.4e-07
medulloblastoma, large-cell 2.300 3.6e-05
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-02
lung cancer 1.800 1.3e-04
nasopharyngeal carcinoma 1.100 4.7e-03
ovarian cancer 1.300 3.9e-04

Protein-protein Interaction (1)

Gene RIF (99)

PMID Text
26893822 Report failed upregulation of TFAM protein and mitochondrial DNA in oxidatively deficient fibers in skeletal muscle of chronic obstructive pulmonary disease patients.
26797282 our results revealed that stimulation of mitochondrial biogenesis by carvedilol resulted in functional gain of the mitochondria by showing increased oxygen consumption and mitochondrial respiratory rate.
26445116 Results showed that TFAM formed oligomers in mitochondria by in situ chemical cross-linking and suggested the importance of the dimerization of TFAM molecules in the distribution of mtDNA in cells.
26307971 Data show that mtTFA proteins are highly expressed in cancer and drug-resistant cells compared to normal cells, and the mtTFA expression is upregulated by signals of oxidative and DNA damage stress in cancer cells. [review]
25822152 TFAM overexpression suppressed mitoROS and their upregulation in rat cardiomyocytes.
25556274 indicating that miRNA-214 and MTFA may become important candidates for developing promising therapeutic strategies for the treatment of cervical cancer
25243473 expression of PGC1alpha and TFAM varies between ovarian carcinoma subtypes; clear-cell carcinoma consists of undetectability of PGC1alpha/TFAM, and low ERalpha/Ki-67. high-grade serous carcinomas had a converse state of PGC1alpha/TFAM, ERalpha positivity and high Ki-67 index
25108120 The combination of strong mtTFA expression and a high survivin index may predict a poor prognosis in patients with pancreatic ductal adenocarcinoma
24875355 The mitochondria targeting sequence-deficient hTFAM also repressed Tfam promoter activity to the same degree as hTFAM.
24837562 Methylation of TFAM promoters changed 2 days after gastric bypass.
24768991 These data disclose a novel mechanism by which ERK1/2 regulates mitochondrial function through direct phosphorylation of TFAM.
24622070 Data suggest that miitochondrial transcription factor A (mtTFA) may be a novel target for the treatment of pancreatic ductal adenocarcinoma (PDAC).
24435062 TFAM dimerization enhances mitochondrial DNA compaction by promoting looping of the DNA.
24413562 The results reveal the organization of TFAM, POLRMT and TFB2M around the light-strand promoter and represent the first structural characterization of the entire mitochondrial transcriptional initiation complex.
24367550 The results suggest that the expression of mtTFA mRNA and protein is down-regulated in the lung tissue from the COPD patients with squamous cell lung cancer, and the level of mtTFA protein is related to apoptosis of pulmonary vascular endothelial cells.
24184878 These data show that the TFAM SNP rs2306604 A allele may be a risk factor for Parkinson's disease dementia, particularly in males, but not for dementia with Lewy bodies
24002170 overexpression of miRNA-23b in U251 cells markedly inhibited the proliferation, cell cycle progression, migration and colony formation, while overexpression of TFAM significantly enhanced these biological processes
23991223 results demonstrate that TFAM uniformly coats the whole mitochondrial genome, with no evidence of robust TFAM binding to the nuclear genome
23645454 Taken together, our data suggested that TFAM plays a crucial role in regulating mtDNA amplification and mitochondrial biogenesis under IR conditions.
23201127 In cells with normal mitochondrial DNA levels, phosphorylated TFAM is degraded by Lon.
23012404 Findings suggest that transcription factor A (TFAM) is absolutely required to recruit the transcription machinery during initiation of transcription.
22910359 TFAM protein sliding and DNA denaturation are essential for mitochondrial DNA organization.
22841477 The expression of TFAM protein was not significantly reduced in ClpX-knockdown cells.
22709542 Recombinant TFAM increased mitochondrial DNA and abolished the activation of nuclear factor of activated T cells (NFAT), which is well known to activate pathological hypertrophy.
22675199 Plasmacytoid dendritic cells (pDC) contribute to sterile immune responses by recognizing the mitochondrial component of necrotic cells (TFAM), with TFAM and mitochondrial DNA as likely mediators of pDC activation.
22354563 The present study suggests that overexpression of TFAM has a potential to reduce oxidative stress in motor neuron and delay onset of the disease in amyotrophic lateral sclerosis model mice
22306509 study demonstrates that mtDNA damage is involved in liver damage in extrahepatic cholestatic patients. The mtDNA damage is attributable to the loss of TFAM
22266811 The survival of patients with positive mtTFA expression was significantly worse than that of patients with negative mtTFA expression.
22129993 TFAM-deficient fibroblasts promote breast cancer tumor growth in vivo, without increasing tumor angiogenesis.
22098591 correlation between mitochondrial transcription factor A expression and BCL2L1 expression in ovarian cancer cell lines & clinical specimens; results suggest mtTFA is prognostic factor for poor ovarian cancer outcome and may regulate genes like BCL2L1
22037172 Data suggest that TFAM bends the mitochondrial light strand promoter to create an optimal DNA arrangement for transcriptional initiation while facilitating DNA compaction elsewhere in the genome.
22037171 Data show that human Tfam forces promoter DNA to undergo a U-turn, reversing the direction of the DNA helix.
21799244 This study suggested that two synergistic interactions between subhaplogroup H5 and APOE4 status (p = 0.009) and between TFAM rs1937 and APOE4 status (p < 0.001) were detected, influencing LOAD risk.
21467167 Data provide evidence that a high incidence of TFAM truncating mutations leads to mitochondrial copy number reduction and mitochondrial instability, distinguishing most CRC with MSI from MSS CRC.
21453679 These results imply that mtTFA functions in both nuclei and mitochondria to promote cancer cell growth.
21081181 comparison between the 5'UTR length and the distribution of the different transcripts showed that the transcripts with the shortest TFAM 5'UTR are present in all the investigated tissues, while the longest 5'UTR seems to be related to tissue-specificity
20977898 This study provides the evidence that variations in TFAM are involved in the pathogenesis of sporadic LOAD in the Han Chinese population.
20977898 Observational study of gene-disease association. (HuGE Navigator)
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20863902 We found four common TFAM polymorphisms, with allele/genotype frequencies that did not differ between early onset myocardial infarction patients and controls.
20863902 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20739229 TFAM modulates mitochondrial base excision repair by virtue of its DNA binding activity and protein interactions.
20643228 POLG expression was related to decreased mtDNA copy number, and its overexpression associated with TFAM expression levels also have an impact on long-term survival among GBM type diffusely infiltrating astrocytomas patients.
20574532 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20432700 TFAM gene Ser12Thr polymorphism is associated with physical performance of athletes.
20432700 Observational study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
20410300 only two essential initiation factors, TFAM and TFB2M, and two promoters, LSP and HSP1, are required to drive transcription of the mitochondrial genome
20202876 Our findings suggest a potential role of promoter TFAM methylation in the pathogenesis of insulin resistance in adolescents.
19925850 Potentially functional polymorphic TFAM variants might influence PD risk alone or depending on mitochondrial haplogroup/haplogroup cluster background.
19925850 Observational study of gene-disease association. (HuGE Navigator)
19885567 These results suggest that TRX2 not only functions as an antioxidant, but also supports mtTFA functions
19681768 TFAM protein levels are higher in conditions with enhanced oxidative capacity
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19624753 On supercoiled templates, the promoter-independent activity was strongly suppressed by a putatively physiological amount of TFAM, while promoter-dependent transcription was inhibited to a lesser extent.
19496804 Data suggest that Tfam overexpression protects mitochondria against Abeta-induced oxidative damage in SH-SY5Y cells.
19304746 The X-ray crystal structure of h-mtTFA box B, revealed the features of a noncanonical HMG box.
19209188 Meta-analysis of gene-disease association. (HuGE Navigator)
19192634 Data show that overexpression of delta 5Tfam causes an increase of mitochondrial transcription, so also this isoform as a role in the mitochondrial process.
19148128 Observational study of gene-disease association. (HuGE Navigator)
19096125 determined the variation in the TFAM, TFB1M, and TFB2M genes in cardiac hypertrophy
19096125 Observational study of gene-disease association. (HuGE Navigator)
18980857 Observational study of gene-disease association. (HuGE Navigator)
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
18716221 Overexpression of TFAM is therefore considered to ameliorate age-dependent impairment of the brain functions through the prevention of oxidative stress and mitochondrial dysfunctions in microglia.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18642640 The nigral dopamine neurons of MitoPark mice show respiratory chain dysfunction, accompanied by the development of intraneuronal inclusions and cell death. In early adulthood, the mice show progressing loss of motor function.
18451773 Observational study of gene-disease association. (HuGE Navigator)
18430995 Observational study of gene-disease association. (HuGE Navigator)
18258228 PHB1 maintains the organization and copy number of the mtDNA through both TFAM-independent and -dependent pathways.
18248889 TFAM-variants did not contribute to the risk of developing Parkinson disease
18248889 Observational study of gene-disease association. (HuGE Navigator)
18028422 Data suggested that the mitochondrial targeting sequence of hTFAM may extend beyond the cleavable presequence.
17707600 Transcription factor ZNF143 is required for expression of TFAM gene.
17537576 Observational study of gene-disease association. (HuGE Navigator)
17537576 rs2306604 A-allele of mitochondrial transcription factor A could be a moderate risk factor for Alzheimer's diseae
17497594 Observational study of gene-disease association. (HuGE Navigator)
17497594 Three polymorphisms in the TFAM gene rs1937, rs2306604 and rs1049432 do not predict endurance capacity/trainability in Chinese males.
17339235 We have determined whether POLG and TFAM have functional roles in post-ejaculatory sperm mtDNA.
17192785 Meta-analysis of gene-disease association. (HuGE Navigator)
17167045 the C-terminal tail of TFAM is important for the strong general binding to mtDNA; this strong DNA-binding conferred by the C-tail may play an important role in the nucleoid structure
16631115 These results suggest that PGC-1alpha variants with Gly/Gly at 482nd amino acid may impair the Tfam transcription, a regulatory function of mitochondrial biogenesis, resulting in dysfunctional mtDNA replication.
16428295 PDIP38 is located in the mitochondrial matrix. TFAM and mitochondrial single-stranded DNA binding protein (mtSSB) are co-immunoprecipitated with PDIP38
16385451 Observational study of gene-disease association. (HuGE Navigator)
16202542 we have determined its chromosomal localization, suggesting that its locus is highly conserved; we have searched for the presence of the delta5 isoform, demonstrating that it is present only in hominids
16043643 Overexpression of TFAM in transgenic mice inhibited left ventricular remodeling after myocardial infarct and may provide a novel therapeutic strategy of cardiac failure.
15547250 Overexpression of mitochondrial transcription factor A (TFAM) stimulates mitochondrial DNA transcription, but is not sufficient to stimulate mitochondrial DNA replication.
15526033 TFAM induces a structural change of the promoter that is required for POLRMT-dependent promoter recognition
15509786 mtDNA amount is finely correlated with the amount of TFAM but not with the transcription level
15464268 Observational study of gene-disease association. (HuGE Navigator)
15464268 There was an association of genotype rs1937G/G with Alzheimer disease in females and an association of a TFAM haplotype with Alzheimer disease both in the whole sample and in females.
12921794 This study describe a family with autosomal dominant progressive external ophthalmoplegia caused by a novel heterozygous A to C transversion at nucleotide 956 of the Twinkle gene.
12897151 TFB1 interacts with the C-terminal activation region of h-mtTFA and stimulates transcription independently of its RNA methyltransferase activity
12839966 Tfam interacts with p53 protein and helps regulate DNA damage.
12686611 both the mitochondrial transcription factor TFAM and mitochondrial single-stranded DNA-binding protein colocalize with Twinkle in intramitochondrial foci
12127986 mtTFA plays an important role in the recognition of oxidative DNA damage.
11964388 the effects of mitochondrial transcription factor A (TFAM) and single-stranded DNA-binding protein (mtSSB) on D-loops

AA Sequence

MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA      1 - 70
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR     71 - 140
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR    141 - 210
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC                                      211 - 246
//

Text Mined References (142)

PMID Year Title
26893822 2016 Failed upregulation of TFAM protein and mitochondrial DNA in oxidatively deficient fibers of chronic obstructive pulmonary disease locomotor muscle.
26797282 2016 Carvedilol promotes mitochondrial biogenesis by regulating the PGC-1/TFAM pathway in human umbilical vein endothelial cells (HUVECs).
26445116 2015 Interaction of human mitochondrial transcription factor A in mitochondria: its involvement in the dynamics of mitochondrial DNA nucleoids.
26307971 2015 Mitochondrial Transcription Factor A and Mitochondrial Genome as Molecular Targets for Cisplatin-Based Cancer Chemotherapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25822152 2015 Overexpression of TFAM or twinkle increases mtDNA copy number and facilitates cardioprotection associated with limited mitochondrial oxidative stress.
25556274 2014 The inhibitory role of miR-214 in cervical cancer cells through directly targeting mitochondrial transcription factor A (TFAM).
25416956 2014 A proteome-scale map of the human interactome network.
25243473 2014 Expression of mitochondrial regulators PGC1? and TFAM as putative markers of subtype and chemoresistance in epithelial ovarian carcinoma.
25108120 2015 The combination of strong immunohistochemical mtTFA expression and a high survivin index predicts a shorter disease-specific survival in pancreatic ductal adenocarcinoma.
24875355 2014 Negative transcriptional regulation of mitochondrial transcription factor A (TFAM) by nuclear TFAM.
24837562 Altered promoter methylation of PDK4, IL1 B, IL6, and TNF after Roux-en Y gastric bypass.
24768991 2014 ERK-mediated phosphorylation of TFAM downregulates mitochondrial transcription: implications for Parkinson's disease.
24622070 2014 Mitochondrial transcription factor a worsens the clinical course of patients with pancreatic cancer through inhibition of apoptosis of cancer cells.
24435062 2014 Distinct structural features of TFAM drive mitochondrial DNA packaging versus transcriptional activation.
24413562 2014 Organization of the human mitochondrial transcription initiation complex.
24367550 2013 Expression and methylation of mitochondrial transcription factor a in chronic obstructive pulmonary disease patients with lung cancer.
24184878 2013 Association of a polymorphism in mitochondrial transcription factor A (TFAM) with Parkinson's disease dementia but not dementia with Lewy bodies.
24002170 2013 TFAM is directly regulated by miR-23b in glioma.
23991223 2013 Genome-wide analysis reveals coating of the mitochondrial genome by TFAM.
23645454 2013 Mitochondrial transcription factor A regulated ionizing radiation-induced mitochondrial biogenesis in human lung adenocarcinoma A549 cells.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23201127 2013 Phosphorylation of human TFAM in mitochondria impairs DNA binding and promotes degradation by the AAA+ Lon protease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23012404 2012 Mammalian transcription factor A is a core component of the mitochondrial transcription machinery.
22910359 2012 Protein sliding and DNA denaturation are essential for DNA organization by human mitochondrial transcription factor A.
22841477 2012 Maintenance of mitochondrial genome distribution by mitochondrial AAA+ protein ClpX.
22709542 2012 Recombinant mitochondrial transcription factor A protein inhibits nuclear factor of activated T cells signaling and attenuates pathological hypertrophy of cardiac myocytes.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22675199 2012 Mitochondrial transcription factor A serves as a danger signal by augmenting plasmacytoid dendritic cell responses to DNA.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22493245 2012 Transcription from the second heavy-strand promoter of human mtDNA is repressed by transcription factor A in vitro.
22354563 2012 Effect of mitochondrial transcription factor a overexpression on motor neurons in amyotrophic lateral sclerosis model mice.
22306509 2012 Damage to mtDNA in liver injury of patients with extrahepatic cholestasis: the protective effects of mitochondrial transcription factor A.
22266811 2012 Clinical significance of mitochondrial transcription factor A expression in patients with colorectal cancer.
22129993 2011 Mitochondrial oxidative stress in cancer-associated fibroblasts drives lactate production, promoting breast cancer tumor growth: understanding the aging and cancer connection.
22098591 2012 Mitochondrial transcription factor A regulates BCL2L1 gene expression and is a prognostic factor in serous ovarian cancer.
22037172 2011 Human mitochondrial transcription factor A induces a U-turn structure in the light strand promoter.
22037171 2011 The mitochondrial transcription and packaging factor Tfam imposes a U-turn on mitochondrial DNA.
21948790 2012 Transcriptional activation by mitochondrial transcription factor A involves preferential distortion of promoter DNA.
21799244 2011 The impact of mitochondrial and nuclear DNA variants on late-onset Alzheimer's disease risk.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21514422 2011 Aberrant cell proliferation by enhanced mitochondrial biogenesis via mtTFA in arsenical skin cancers.
21467167 2011 Frequent truncating mutation of TFAM induces mitochondrial DNA depletion and apoptotic resistance in microsatellite-unstable colorectal cancer.
21453679 2011 Human mitochondrial transcription factor A functions in both nuclei and mitochondria and regulates cancer cell growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21081181 2011 New isoforms of human mitochondrial transcription factor A detected in normal and tumoral cells.
20977898 2011 Mitochondrial transcription factor A (TFAM) polymorphisms and risk of late-onset Alzheimer's disease in Han Chinese.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20863902 2011 Mitochondrial DNA and TFAM gene variation in early-onset myocardial infarction: evidence for an association to haplogroup H.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20739229 2010 The mitochondrial transcription factor A functions in mitochondrial base excision repair.
20643228 2011 Mitochondrial DNA depletion and its correlation with TFAM, TFB1M, TFB2M and POLG in human diffusely infiltrating astrocytomas.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20562347 2010 Core human mitochondrial transcription apparatus is a regulated two-component system in vitro.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20432700 [Association of the mitochondrial transcription factor (TFAM) gene polymorphism with physical performance of athletes].
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
20410300 2010 Human mitochondrial transcription revisited: only TFAM and TFB2M are required for transcription of the mitochondrial genes in vitro.
20202876 2010 Methylation of TFAM gene promoter in peripheral white blood cells is associated with insulin resistance in adolescents.
19925850 2010 Mitochondrial transcription factor A variants and the risk of Parkinson's disease.
19885567 2009 Thioredoxin2 enhances the damaged DNA binding activity of mtTFA through direct interaction.
19681768 2010 Training response of mitochondrial transcription factors in human skeletal muscle.
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19624753 2009 DNA conformation-dependent activities of human mitochondrial RNA polymerase.
19496804 2009 Overexpression of Tfam protects mitochondria against beta-amyloid-induced oxidative damage in SH-SY5Y cells.
19304746 2009 Structural analysis and DNA binding of the HMG domains of the human mitochondrial transcription factor A.
19209188 2009 Genetic association analysis of 13 nuclear-encoded mitochondrial candidate genes with type II diabetes mellitus: the DAMAGE study.
19192634 2007 The smaller isoform of the mitochondrial transcription factor A has a role in the mitochondrial transcription.
19148128 2009 Maternal pregestational BMI is associated with methylation of the PPARGC1A promoter in newborns.
19096125 2008 Mitochondrial transcription factors TFA, TFB1 and TFB2: a search for DNA variants/haplotypes and the risk of cardiac hypertrophy.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18980857 2009 Mutational screening of the mitochondrial transcription factors B1 and B2 (TFB1M and TFB2M) in Parkinson's disease.
18830724 2009 Assessment of Alzheimer's disease case-control associations using family-based methods.
18716221 2008 Reverse of age-dependent memory impairment and mitochondrial DNA damage in microglia by an overexpression of human mitochondrial transcription factor a in mice.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18642640 2008 Transgenic rodent models of Parkinson's disease.
18451773 2008 A decreased mitochondrial DNA content is related to insulin resistance in adolescents.
18430995 2008 Mitochondrial transcription factor A (TFAM) gene variation and risk of late-onset Alzheimer's disease.
18258228 2008 Human prohibitin 1 maintains the organization and stability of the mitochondrial nucleoids.
18248889 2008 Mitochondrial transcription factor A (TFAM) gene variation in Parkinson's disease.
18072287 2008 Maintenance of mitochondrial DNA copy number and expression are essential for preservation of mitochondrial function and cell growth.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18028422 2007 Human mitochondrial transcription factor A possesses multiple subcellular targeting signals.
17707600 2007 Transcription factor hStaf/ZNF143 is required for expression of the human TFAM gene.
17537576 2007 Association study of two genetic variants in mitochondrial transcription factor A (TFAM) in Alzheimer's and Parkinson's disease.
17497594 2007 Relationship between TFAM gene polymorphisms and endurance capacity in response to training.
17339235 2007 The expression of polymerase gamma and mitochondrial transcription factor A and the regulation of mitochondrial DNA content in mature human sperm.
17192785 2007 Systematic meta-analyses of Alzheimer disease genetic association studies: the AlzGene database.
17167045 2007 The C-terminal tail of mitochondrial transcription factor a markedly strengthens its general binding to DNA.
16631115 2006 Impaired coactivator activity of the Gly482 variant of peroxisome proliferator-activated receptor gamma coactivator-1alpha (PGC-1alpha) on mitochondrial transcription factor A (Tfam) promoter.
16428295 2005 PDIP38 associates with proteins constituting the mitochondrial DNA nucleoid.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16202542 2005 History of the Tfam gene in primates.
16043643 2005 Overexpression of mitochondrial transcription factor a ameliorates mitochondrial deficiencies and cardiac failure after myocardial infarction.
15965051 2005 Mitochondrial transcription factor A in the maintenance of mitochondrial DNA: overview of its multiple roles.
15547250 2004 Transient overexpression of mitochondrial transcription factor A (TFAM) is sufficient to stimulate mitochondrial DNA transcription, but not sufficient to increase mtDNA copy number in cultured cells.
15526033 2004 The mitochondrial RNA polymerase contributes critically to promoter specificity in mammalian cells.
15509786 2004 Architectural role of mitochondrial transcription factor A in maintenance of human mitochondrial DNA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464268 2004 Possible association of mitochondrial transcription factor A (TFAM) genotype with sporadic Alzheimer disease.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15126285 2004 Regulation of mitochondrial transcription factor A expression by high glucose.
14969715 2004 Up-regulation of mitochondrial transcription factor 1 mRNA levels by GH in VSMC.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12921794 2003 A novel Twinkle gene mutation in autosomal dominant progressive external ophthalmoplegia.
12897151 2003 Human mitochondrial transcription factor B1 interacts with the C-terminal activation region of h-mtTFA and stimulates transcription independently of its RNA methyltransferase activity.
12839966 2003 P53 physically interacts with mitochondrial transcription factor A and differentially regulates binding to damaged DNA.
12686611 2003 Composition and dynamics of human mitochondrial nucleoids.
12626705 2003 Human mitochondrial DNA is packaged with TFAM.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12428064 2002 Human mitochondrial transcription factor A reduction and mitochondrial dysfunction in Hashimoto's hypothyroid myopathy.
12127986 2002 Human mitochondrial transcription factor A binds preferentially to oxidatively damaged DNA.
12095695 2002 Human mitochondrial transcription factor A (mtTFA): gene structure and characterization of related pseudogenes.
11972329 2002 Modulation of mitochondrial transcription in response to mtDNA depletion and repletion in HeLa cells.
11964388 2002 Regulation of mitochondrial D-loops by transcription factor A and single-stranded DNA-binding protein.
11668394 2001 Downregulation of Tfam and mtDNA copy number during mammalian spermatogenesis.
11457459 2001 Increased expression of mitochondrial transcription factor A and nuclear respiratory factor-1 in skeletal muscle from aged human subjects.
9679658 1998 Inhibition of mitochondrial gene expression by antisense RNA of mitochondrial transcription factor A (mtTFA).
9309692 1997 Regulation of mitochondrial transcription by mitochondrial transcription factor A.
9181464 1997 Interferons suppress mitochondrial gene transcription by depleting mitochondrial transcription factor A (mtTFA).
9063738 1997 Down-regulation of mitochondrial transcription factor A during spermatogenesis in humans.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8441424 1993 A human mitochondrial transcriptional activator can functionally replace a yeast mitochondrial HMG-box protein both in vivo and in vitro.
8333869 1993 Smaller isoform of human mitochondrial transcription factor 1: its wide distribution and production by alternative splicing.
8166737 1994 Stoichiometry of mitochondrial transcripts and regulation of gene expression by mitochondrial transcription factor A.
8108407 1994 Activation of the human mitochondrial transcription factor A gene by nuclear respiratory factors: a potential regulatory link between nuclear and mitochondrial gene expression in organelle biogenesis.
8061564 1994 DNA binding properties of recombinant human mitochondrial transcription factor 1.
7969115 1994 In organello footprint analysis of human mitochondrial DNA: human mitochondrial transcription factor A interactions at the origin of replication.
7849699 1994 Deficiency of the human mitochondrial transcription factor h-mtTFA in infantile mitochondrial myopathy is associated with mtDNA depletion.
7789991 1995 Chromosomal localization of mitochondrial transcription factor A (TCF6), single-stranded DNA-binding protein (SSBP), and endonuclease G (ENDOG), three human housekeeping genes involved in mitochondrial biogenesis.
7599198 1995 Human mitochondrial transcription factor A and promoter spacing integrity are required for transcription initiation.
3594571 1987 Promoter selection in human mitochondria involves binding of a transcription factor to orientation-independent upstream regulatory elements.
3211148 1988 Purification and characterization of human mitochondrial transcription factor 1.
2628167 1989 Flexible recognition of rapidly evolving promoter sequences by mitochondrial transcription factor 1.
2035027 1991 Similarity of human mitochondrial transcription factor 1 to high mobility group proteins.
1737790 1992 DNA wrapping and bending by a mitochondrial high mobility group-like transcriptional activator protein.
1610904 1992 Upstream region of a genomic gene for human mitochondrial transcription factor 1.