Property Summary

NCBI Gene PubMed Count 317
PubMed Score 13447.91
PubTator Score 11381.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.5
Disease Target Count
Atransferrinemia 8

Expression

  Differential Expression (26)

Disease log2 FC p
Atopic dermatitis -1.900 1.2e-02
atypical teratoid / rhabdoid tumor -3.400 6.5e-04
Breast cancer -2.900 3.3e-15
breast carcinoma -2.500 3.2e-04
chronic rhinosinusitis 3.132 2.3e-03
cystic fibrosis and chronic rhinosinusit... 2.488 3.4e-04
ductal carcinoma in situ -3.300 1.1e-02
ependymoma -3.500 4.1e-10
esophageal adenocarcinoma -2.000 4.2e-02
glioblastoma multiforme -1.400 4.8e-04
group 3 medulloblastoma -2.500 4.2e-02
intraductal papillary-mucinous adenoma (... -1.500 1.7e-02
intraductal papillary-mucinous carcinoma... -1.600 1.5e-02
invasive ductal carcinoma -4.100 5.6e-03
lung cancer 4.400 5.7e-05
medulloblastoma, large-cell -3.500 2.2e-03
oligodendroglioma -1.100 4.7e-03
osteosarcoma -5.292 1.1e-06
pancreatic cancer -1.100 3.5e-02
pediatric high grade glioma -1.900 2.0e-02
Pick disease -2.000 1.1e-04
pituitary cancer -2.000 1.9e-03
primitive neuroectodermal tumor -1.900 3.8e-02
progressive supranuclear palsy -1.700 4.4e-02
psoriasis -1.300 3.6e-02
subependymal giant cell astrocytoma -5.373 3.4e-03

 OMIM Phenotype (1)

PDB (37)

Gene RIF (245)

AA Sequence

MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRA      1 - 70
IAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTG     71 - 140
LGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGA    141 - 210
FKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKED    211 - 280
LIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC    281 - 350
PEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK    351 - 420
CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKI    421 - 490
NHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQN    491 - 560
TGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSN    561 - 630
VTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP      631 - 698
//

Text Mined References (325)

PMID Year Title