Property Summary

NCBI Gene PubMed Count 298
PubMed Score 13124.31
PubTator Score 11381.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Atransferrinemia 8

Expression

  Differential Expression (26)

Disease log2 FC p
esophageal adenocarcinoma -2.000 4.2e-02
psoriasis -1.300 3.6e-02
glioblastoma multiforme -1.400 4.8e-04
oligodendroglioma -1.100 4.7e-03
osteosarcoma -5.552 6.1e-08
ependymoma -3.500 4.1e-10
sonic hedgehog group medulloblastoma -3.700 2.8e-04
atypical teratoid/rhabdoid tumor -4.400 4.4e-07
medulloblastoma, large-cell -3.500 2.2e-03
primitive neuroectodermal tumor -1.900 3.8e-02
Atopic dermatitis -1.900 1.2e-02
intraductal papillary-mucinous adenoma (... -1.600 8.6e-03
intraductal papillary-mucinous carcinoma... -1.700 6.2e-03
lung cancer 4.400 5.7e-05
pancreatic cancer -1.100 3.5e-02
breast carcinoma -2.500 3.2e-04
pediatric high grade glioma -2.000 9.1e-03
subependymal giant cell astrocytoma -5.373 3.4e-03
non-inflammatory breast cancer -3.300 7.4e-07
Pick disease -2.000 1.1e-04
progressive supranuclear palsy -1.900 1.1e-02
ductal carcinoma in situ -3.300 1.1e-02
invasive ductal carcinoma -4.100 5.6e-03
pituitary cancer -2.000 1.9e-03
chronic rhinosinusitis 3.132 2.3e-03
cystic fibrosis and chronic rhinosinusit... 2.488 3.4e-04

 OMIM Phenotype (1)

Gene RIF (229)

PMID Text
26852655 Total iron binding capacity was strongly associated with variants in and near the TF gene, and with variants in HFE gene in premenopausal women of European descent.
26392563 Data show that transferrin (Tf) was attached to nanoparticles with an acid-cleavable linkage that facilities release of nanoparticles from Tf that are bound to Tf receptors (TfR) during transcytosis, promoting entry of the nanoparticles into the brain.
26116962 activation of PI3K/Akt by retinoic acid modulates AMPK activity in ECs and plays a crucial role in the inhibition of coagulatory factors such as TF, PAI-1, and HMGB1 in inflammatory conditions
26099594 TF severed as the carrier to delivery irons, and could directly stimulate cardiomyocytes hypertrophy.
25914390 Data suggest that up-regulation of serum transferrin levels is positively associated with risk of metabolic syndrome and overweight/obesity, but not with risk of diabetes among Chinese men and women.
25809685 genetic association studies in a population of black women in South Africa: Data confirm that an SNP in TF (rs1799852) is associated with iron status/iron-deficiency anemia in the population studied.
25716754 Data suggest that the 15 disulfide bonds in transferrin vary in their susceptibility to reduction and in their contribution to protein conformation/stability.
25486930 Hereditary hypotransferrinemia caused by novel transferrin mutations can lead to elevated transferrin saturation and, when associated with HFE or HAMP mutations, to iron overload.
25457201 identified the rs3811647 polymorphism in the TF gene as the only SNP significantly associated with iron metabolism through serum transferrin and iron levels
25375118 Results show that higher TF expression in patients with hypereosinophilic disorders may contribute to increase the thrombotic risk.
25298206 apelin-13 has a role in inducing expression of prothrombotic tissue factor
25287020 Infants born to mothers with the HFE C282Y gene missense variant but not the TF P570S or HFE H63D gene missense variants had lower umbilical cord blood lead levels relative to those born to women who were wild-type.
25224454 significant associations between serum iron binding capacity levels and two SNPs around TF on chromosome 3 were identified.
25163484 Human transferrin is internalized across the mycobacterial cell wall in a GAPDH-dependent manner within infected macrophages.
25000850 H2O2 induces the expression of transferrin, and consequently, decreased iron absorption, suggests a novel mechanism for iron deficiency in pediatric non-alcoholic steatohepatitis patients.
24972167 Understanding the interaction between [Cr(phen)3](3+) with transferrin is relevant because this protein could be a delivery agent of Cr(III) complex to tumor cells.
24830293 HIV-1 MA associates with transferrin in recycling endosomes in human vaginal epithelial cells
24667918 HIV-1 MA associates with transferrin in recycling endosomes in human vaginal epithelial cells
24599423 decreased circulating levels in abdominal aortic aneurysm
24350254 did not find any association between the c.-2G>A polymorphism and keratoconus; no association was found between transferrin polymorphisms and Fuchs endothelial corneal dystrophy occurrence
24256706 Increased urinary excretion of plasma proteins such as IgG, ceruloplasmin and transferrin, with different molecular radii of 55 A or less and different isoelectric points precede development of microalbuminuria in patients with NIDDM and hypertension.
23888904 Transferrin mutations were found in several members of 2 non-consanguineous families with hypochromic microcytic anemia & hemodiserosis. The missense mutations were 1940 A>T & 1825 C>T.
23875541 Elevated BMI reduces the diagnostic utility of carbohydrate-deficient transferrin at higher alcohol intake in subjects with liver disease.
23817740 Studies indicate that several genes have been linked to iron homeostasis, including transferrin (TF), iron regulatory protein 1 (ACO1) and transferrin receptor 2 (TFR2).
23588470 The A allele of SNP rs3811647 increases Tf expression in a manner that might underlie inter-individual variation in serum transferrin levels
23372701 HIV-1 MA associates with transferrin in recycling endosomes in human vaginal epithelial cells
23256035 The structures of hTF observed here represent key conformers captured in the dynamic nature of the transferrin family proteins and provide a structural basis for understanding the mechanism of metal uptake and release in transferrin families.
23089144 We found that the serum transferrin was associated with the rs8177178 (p < 0.001) and rs4481157 (p < 0.01) polymorphisms, and the common variant (GG) of both sites was related to a lower level of transferrin.
23027680 Data suggest that there is no association between plasma level of carbohydrate-deficient transferrin and volume decrease of brain gray or white matter in male subjects as result of current/recent or lifetime alcohol drinking in the Netherlands.
22938499 TF translocates to the cell front in association with cytoskeleton proteins and regulates HVSMC migration by mechanisms dependent and independent of factor (F)VIIa/PAR2
22923205 study of effect of occupational exposure to lead among metallurgy workers in Poland on blood levels of transferrin (TRF), ceruloplasmin (CER) and haptoglobin (HPG): Transferrin levels were unchanged in exposed group compared with control group.
22873711 The study demonstrates for the first time that the protonation of Tyr188 is required for the release of metal from iron- and aluminum-loaded serum transferrin.
22861364 Patients with newly diagnosed type 1 diabetes have lower apoTf serum levels than healthy controls & patients with long-lasting disease. apoTf has a pivotal role in the perpetuation of type 1 diabetes pathology.
22829284 Bovine prolactin improved the expression of human transferrin through such a possible mechanism that bovine prolactin activated STAT5a transcription expression.
22819264 Therefore, we envision that the antithrombotic activity of CORM-2 might be used as a pharmaceutical agent for the treatment of various inflammatory conditions.
22726553 We demonstrate that visfatin induces transcription of mRNA for TF by Real Time PCR.
22722730 study indicates that HIV-infected women in Rwanda with a TF CD phenotype have a significantly higher prevalence of certain opportunistic infections and significantly lower TF concentrations than subjects with the TF CC phenotype
22458330 BfrA, BfrD and BfrE are catecholamine receptors and are involved in the utilization of iron liberated from transferrin by host catecholamine stress hormones.
22424853 The lower inhibition of tissue factor and greater endothelial dysfunction in STEMI than in non-STEMI patients may enhance thrombosis at the culprit lesion and adjacent coronary plaques.
22356162 model in which a series of pH-induced events involving both TFR residue His318 and TF residue His349 occurs to promote receptor-stimulated release of iron from the C-lobe of TF
22343719 transferrin-binding protein B stabilizes the holo form of human transferrin.
22327295 crystal structures of the TbpA-transferrin complex and of the corresponding co-receptor TbpB
22323359 TF, TFR2 and TMPRSS6 polymorphisms are significantly associated with decreased iron status, but only variants in TMPRSS6 are genetic risk factors for iron deficiency and iron-deficiency anemia.
22232660 study found that partially overlapping additive genetic factors influenced transferrin levels and brain microstructure; a commonly carried polymorphism (H63D at rs1799945) in the hemochromatotic HFE gene was associated with white matter fiber integrity
22191507 identification of a number of residues that are critical to formation of and release of iron from the hTF-TFR complex
22159020 retinal function and gene expression of some of the iron-associated genes are significantly altered.
22041858 The study reports the chemical association of Titanium to TF "in vivo" under different chromatographic conditions by elemental mass spectrometry using double focusing inductively coupled plasma (DF-ICP-MS) as detector.
21904748 UV-VIS absorbance is employed here to monitor the iron content in human holo-transferrin (TF) under various solvent conditions, changing polarity, pH, ionic strength, and the ionic and hydrophobic environment of the protein.
21881004 These observations suggest that NHE6 regulates clathrin-dependent endocytosis of transferrin via pH regulation.
21873562 Elevated transferrin saturation confers a two- to threefold increased risk of developing any form of diabetes, as well as type 1 and type 2 diabetes separately.
21866866 Gene diversity for haptoglobin and transferrin classical markers among Hindu and Muslim populations of Aligarh City, India.
21820158 Circulating active TF and FXIa can occur in patients with cerebrovascular ischemic events >/=6 months after the events. The presence of these factors is associated with worse functional outcomes, persistent hypercoagulable state in cerebrovascular disease.
21811575 Experimental meningococcal sepsis in congenic transgenic BALB/c mice expressing human transferrin, was studied.
21788477 The structure elucidates how the TFR accelerates iron release from the C lobe, slows it from the N lobe, and stabilizes binding of apohTF for return to the cell surface.
21678080 Results describe competitive binding of Fe(3+), Cr(3+), and Ni(2+) to transferrin (Tf) at various physiological iron to Tf concentration ratios.
21665994 Missense polymorphisms rs1049296 and rs1799899 in TF strongly affecting transferrin glycosylation.
21664032 TF antigen 1.94 times higher in the fetus than in the mother
21643746 Transferrin gene C2 variants are not high-risk genetic variants for schizophrenia/schizoaffective disorder in a Croatian population, nor do they impact on age at onset of the first psychotic symptoms.
21514009 Our results suggest the existence of a link between hemochromatosis and transferrin gene mutations and iron abnormalities that increases the probability of developing Alzheimer's disease when accompanied by a distress of the liver.
21459485 This suggests that the Tf-2/Tf-1 ratio could distinguish iNPH from Alzheimer's disease, and possibly other dementias.
21422745 The A Allele of the -576G>A polymorphism of the transferrin gene is associated with the increased risk of age-related macular degeneration in smokers.
21408069 CSF total-Tf, a new biomarker, when combined with the current biomarker total-tau, is a reliable pre-mortem diagnostic test for Sporadic Creutzfeldt-Jakob-disease .
21389980 The significantly different associations we observed in subgroups suggest that toxic consequences on cognitive function of age-related brain iron increases may differ substantially by gender and genotypes(transferrin c2).
21384276 No significant differences are found in genotype and allele frequencies between Parkinson's disease patients and controls for the transferrin polymorphisms studied.
21376789 Demonstrate a possible damaging impact of various hydrophobic pollutants, which can enter an organism by inhalation or ingestion, on the functionality of the transferrin.
21320285 GSK3 acts as a molecular brake on the signaling pathway, leading to TF expression in monocytes interacting with activated platelets
21113232 Apotransferrin promotes oligodendroglial progenitor cell (OPC) maturation and myelin recovery in the hypoxic corpus callosum by decreasing iron-mediated toxicity and inducing new OPCs from the subventricular zone.
21049900 thermodynamics of the interactions of serum apotransferrin (T) and holotransferrin (TFe(2)) with ceruloplasmin (Cp)
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20817350 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20738776 Transferrin saturation is a predictor of hepatic iron overload.
20721554 Data suggest that dysmetabolic hyperferritinemia is characterized by hyperferritinemia with normal transferrin saturation, elevated hepcidin levels, and mild liver iron overload in a subset of patients.
20708639 The interaction between tamoxifen (TMX) and human serum transferrin (HTF) was for the first time studied at varying pH values by fluorescence spectroscopy, circular dichroism (CD) and resonance light scattering (RLS).
20659343 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634490 transferrin receptor 2 and HFE are involved in holotransferrin-dependent signaling for the regulation of furin which involved Erk phosphorylation. Furin in turn may control hepcidin expression.
20633231 Although substantial domain separation upon binding of Neisseria meningitidis TbpB cannot be excluded, the preferred model of interaction involves binding human transferrin C-lobe in the closed conformation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615872 a mechanistic basis for the antimicrobial activity of human transferrin
20587610 Observational study of gene-disease association. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20447458 The rice-derived recombinant human transferrin was shown to be structurally similar to the native human transferrin, and also functionally the same as native transferrin in terms of reversible iron binding and promoting cell growth and productivity.
20444258 Observational study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
20410508 Human TF expression by both hematopoietic and nonhematopoietic mouse cells contributes to activation of coagulation in mice 8 hours after LPS administration.
20397659 Identification of a kinetically significant anion binding (KISAB) site in the N-lobe of human serum transferrin
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20371432 Almost all of the acute-phase proteins were closely related to rheumatoid arthritis activity (based on DAS28) and their places in the downgrade scale were as follows: CRP, Tf, AGP, Hp and AAT.
20309589 High glucose conditions induces TM expression.
20215856 Observational study of gene-disease association. (HuGE Navigator)
20188707 MRCKalpha takes part in transferrin(Tf)-iron uptake, probably via regulation of Tf-TfR endocytosis/endosome trafficking that is dependent on the cellular cytoskeleton.
20164577 Observational study of gene-disease association. (HuGE Navigator)
20150920 Observational study of gene-disease association. (HuGE Navigator)
20118108 A significant association between blood alcohol concentration and both carbohydrate-deficient transferrin (CDT) values and CDT positivity was found.
20113254 Observational study of gene-disease association. (HuGE Navigator)
20096706 The association constant for the binding of diferric transferrin (Tf) to TfR2alpha is 5.6x10(6) M(-)(1), which is about 50 times lower than that for the binding of Tf to TfR1, with correspondingly reduced rates of iron uptake.
20066543 The levels of Tf in sarcoidosis are high in bronchoalveolar lavage fluid, but low in serum. Increased levels of Tf in BALF may reflect the disease activity.
20064616 Detailed characterization of the C-lobe of hTF includes a mass determination by electrospray ionization mass spectrometry (ESI-MS), analysis of the spectral (absorbance and fluorescence) properties, as well as rate constants for iron release.
20052609 TF showed some association with psychological distress.
20029940 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19921860 Human serum transferrin and ascidian monolobal transferrin bind vanadium with similar strengths; ascidian transferrin requires a synergistic bicarbonate anion for vanadium binding, whereas human serum transferrin does not.
19917294 The four microscopic rate constants required to accurately describe the kinetics of iron removal are reported for hTF with and without the TFR.
19916167 The energy transfer from the three Trp residues at positions 8, 128, and 264 within the human serum transferrin (hTF) N-lobe to the ligand to metal charge transfer band was investigated by monitoring changes in Trp fluorescence emission and lifetimes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19859668 Data suggested that Al(2)Tf cannot form specific ionic interresidual interactions, such as those formed by Fe(2)Tf, to bind to TfR, resulting in impossible complex formation between Al(2)Tf and TfR.
19856410 Observational study of gene-disease association. (HuGE Navigator)
19852572 Transferrin C2 and hemochromatosis C282Y alleles are not associated with increased risk for developing age-related macular degeneration (AMD) in Israel.
19852572 Observational study of gene-disease association. (HuGE Navigator)
19838776 C-lobes of apo TF and Fe(2)TF bind to the helical domain of transferrin receptor, and the N-lobes are sandwiched between the ectodomain of transferrin receptor and the cell membrane as previously reported.
19828835 This shows for the first time that transferrin receptor(TFR)-mediated transferrin-bound iron uptake is mediated primarily via TFR1 but not TFR2 and that a high-capacity TFR-independent pathway exists in hepatoma cells.
19761807 Human growth hormone-transferrin fusion protein promoted a modest but statistically significant weight gain after oral dosing in hypophysectomized rats.
19698254 Observational study of gene-disease association. (HuGE Navigator)
19693784 the N-lobe loop of human serum transferrin is critical for binding to the transferrin receptor as revealed by mutagenesis, isothermal titration calorimetry, and epitope mapping
19670106 Urinary excretion of IgG, transferrin, and ceruloplasmin may be more sensitive indicators of glomerular capillary pressure change than albuminuria in normoalbuminuric diabetic patients.
19650928 Found a modest association of transferrin saturation with peripheral arterial disease, particularly among those with high cholesterol levels.
19583819 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19572083 Observational study of gene-disease association. (HuGE Navigator)
19545871 Observational study of genotype prevalence. (HuGE Navigator)
19515372 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19290554 Iron release from the N-lobe of transferrin is very sensitive to the conformation of the C-lobe, but is insensitive to the presence of the soluble portion of the transferrin receptor or to changes in pH (between 5.6 and 6.4).
19281173 The role of the five C-lobe Trp residues in reporting the fluorescence change has been evaluated.
19254567 Because the HFE alpha3 domain interacts with receptor 2 (TfR2), these results supported the finding that TfR2/HFE complex is required for transcriptional regulation of hepcidin by holo-transferrin.
19250966 we have discovered a novel mitochondrial iron transport system that goes awry in Parkinson's disease, and which may provide a new target for therapeutic intervention.
19228837 protective role of Tf in acute stroke and a possible ambivalent role of ceruloplasmin
19219998 The inability to obtain crystals of the TF G65R mutant led to development of a novel crystallization strategy in which the G65R/K206E double mutation stabilizes a single closed pink conformer and captures Arg65 in a single position.
19176989 Interactions between distinct pools of TF-expressing cells likely influence tumour progression. The release of TF microparticles into the circulation contributes to the systemic coagulopathies commonly observed in cancer patients. Review.
19165391 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19084217 The three variants in TF (rs3811647, rs1799852 and rs2280673) plus the HFE C282Y mutation explained approximately 40% of genetic variation in serum transferrin (p = 7.8 x 10(-25)).
19084217 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19021568 A general mechanism for the interaction of five metal-loaded Transferrins [Fe(III), Al(III), Bi(III), Ga(III) and Co(III)] with transferrin receptor, is reported.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18835036 Apo-transferrin enhanced IL-18 mRNA and IL-18 secretion
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
18813964 Observational study of gene-disease association. (HuGE Navigator)
18795173 The joint presence of variant alleles in the HFE and TF genes showed the greatest effect, suggesting a gene-by-gene-by-environment interaction
18654083 changes in cerebrospinal fluid transferrin glycosylation may play an important role in the pathophysiology of Alzheimer's disease
18597674 in the case of abnormal pregnancies, the fetus may require higher levels of transferrin in order to prevent iron depletion due to the stress from the placental dysfunction
18509548 The role of transferrin in glial protection was investigated.
18442477 di-tri-bridge cannot be explained by genetic transferrin variants in these samples
18395717 HFE and TF genes together may influence the hypothalamic-pituitary-gonadal axis, functioning at the pituitary or testes level.
18344013 increased frequency of transferrin C1C2 genotype found in cystic fibrosis.
18344013 Observational study of gene-disease association. (HuGE Navigator)
18307987 Sialylation of transferrin and total serum proteins reflects the intensity of inflammatory response during acute pancreatitis and could be used as a prognostic parameter for disease severity.
18257091 Upregulation of transferrin is associated with brain metastases in lung cancer
18245657 that TFR2-related HH may occur at a young age and is characterized by high TS levels
18097132 A novel mutation in exon 4, a G-->A transition at cDNA 410(Cys137Tyr) was found in a child with atransferrinemia & her consanguineous parents. Another novel mutation at IVS10(-23)C-->T, presumably a polymorphism, was also documented.
18067952 analysis of tissue factor changes and the effects of tissue factor pathway inhibitor on transient focal cerebral ischemia in rats
18045615 Two haplotypes A-C and G-G constructed of rs4481157-rs3811655 revealed significant associations with schizophrenia (global P=0.0001). Our findings support that TF gene may be involved in susceptibility to schizophrenia in the Chinese Han population.
18022819 stable complex between these Cp and Hp and Tf does not occur under the experimental conditions used
17980706 adjustment of reference intervals for disialotransferrin and carbohydrate-deficient transferrin in relation to ethnicity, age, gender, body mass index and smoking is not required
17976429 The within-person biological variability of transferrin saturation and unsaturated iron-binding capacity limits their usefulness as an initial screening test for expressing C282Y homozygotes.
17728504 Carbohydrate-deficient transferrin (CDT) is considered as the most reliable marker for detecting heavy drinking in Korean males.
17711300 This work combines kinetic results with structural information to provide a more precise description of the steps leading to and immediately following iron release from the N-lobe of hTF.
17640392 This study identifies the PtdIns(3,4,5)P3-mTOR signaling pathway as a new regulator of iron-transferrin uptake
17601350 Observational study of gene-disease association. (HuGE Navigator)
17573378 Serum level of sialic acid in patients with chronic alcohol abuse depends on the concentration of the most sialylated glycoproteins: alpha 1-antitrypsin, alpha 1-acid glycoprotein, and transferrin.
17496814 Observational study of gene-disease association. (HuGE Navigator)
17496814 no significant differences in genotype, allele or haplotype frequencies of the 6 SNPs were found between schizophrenia patients & controls; results suggest the transferrin gene is not related to development of schizophrenia in Japanese population
17206377 Observational study of gene-disease association. (HuGE Navigator)
17206377 G277S mutation carriers did not show the usual inverse association between iron stores and non-haem iron absorption
17192785 Meta-analysis of gene-disease association. (HuGE Navigator)
17119318 Our findings provide new insights into the molecular basis of OLGc differentiation and on the role played by Tf in this process.
17116317 Observational study of gene-disease association. (HuGE Navigator)
17047092 Observational study of gene-disease association. (HuGE Navigator)
17011669 Observational study of gene-disease association. (HuGE Navigator)
17008590 Observational study of gene-disease association. (HuGE Navigator)
16538641 the serum changes in sialic acid and carbohydrate-deficient transferrin levels in the course of type 2 diabetes mellitus are associated with each other in the presence of microangiopathy
16497717 Our studies suggest that AEC I is not just a simple barrier for gas exchange, but a functional cell that protects alveolar epithelium from injury.
16373913 Increased levels in urine predicts development of microalbuminuria in type 2 diabetes.
16339299 Expression of mRNA transcripts for transferrin was increased despite protein expression being reduced by heat shock.
16331960 Results describe the detection of carbohydrate-deficient transferrin based on the premise that glycosylation may afford some degree of protection to proteolytic action.
16300393 Position 632 must have a positively charged residue to elicit a robust rate acceleration as a function of increasing salt. On the basis of these observations, a model for iron release from the hTF C-lobe is proposed
16288727 by generating oxygen radicals, activated U937 cells were able to oxidise LDL; the oxidising process was most pronounced in the presence of copper and could be blocked by Tf
16085060 The competitive interaction of aluminum or iron binding to transferrin prevent normal Fe incorporation into K562 cells and trigger the upregulation of Fe transport.
16047113 Transferrin polymorphism does not behave as a genetic risk factor for either sporadic or familial Parkinson disease.
15975770 The single amino acid substitution in Transferrin C2 variant (Pro 570 Ser) does not affect the general conformation of the protein nor the local structure of the iron binding sites, or their binding properties.
15924420 Binding experiments with HeLa S3 cells indicate that recombinant human TF, in which Tyr426 or His585 is mutated, favor a closed or nearly closed conformation while those with mutations of Asp392 or Tyr517 ligands appear to promote an open conformation.
15892129 This co-culture system represents a potentially powerful tool to study neuron-glia interactions that occur during myelinogenesis and the role of Transferrin in this process.
15698609 Observational study of gene-disease association. (HuGE Navigator)
15648851 Observational study of genotype prevalence. (HuGE Navigator)
15634274 EGF-like domains of factor Xa and factor IXa are important for the activation of the factor VII--tissue factor complex
15536627 fucosylation at the reducing-terminal GlcNAc (Fucalpha1-6GlcNAc) specifically occurred at Asn630, as demonstrated by treatment of the glycopeptides with alpha1-3/4-L-fucosidase
15466165 mutational analysis of patients with atransferrinemia
15327995 Tyr188 is a critical residue not only for iron binding but also for chelator binding and iron release in transferrin
15319290 Transfserrin receptor 2 mRNA levels do not change in cells exposed to diferric transferrin (diferric transferrin)
15271890 degraded by arg-gingipain and lys-gingiapin of Porphyromonas gingivalis, providing sources of iron and peptides which may contribute to tissue destruction by catalyzing the formation of toxic hydroxyradicals
15214510 isolation of transferrin from plasma by ion exchange column chromatography produced a broad pink protein band that subsequently separated on a gel filtration column into three proteins containing many metals.
15214509 In TfC1 homozygotes a shift was found toward higher sialylation, but in TfC1C2 heterozygotes the 5- and 6-sialylated bands were less concentrated
15111541 Urinary levels are increaed in normoalbuminuric type 2 diabetic patients.
15060098 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15060098 The combination of the C2 allele of transferrin and the C282Y allele of the haemochromatosis gene increase susceptibility for developing Alzheimer's disease.
15042587 apotransferrin can influence oligodendroglia gene expression and differentiation through multiple mechanisms depending on the maturation of the cell.
14980223 analysis of the structure of TfR-Tf complex explains differences in the iron-release properties of free and receptor bound Tf
14757931 Observational study of gene-disease association. (HuGE Navigator)
14645044 dynamics simulation of the open form of human serum transferrin apoprotein shows that it is flexible enough to sample conformations that are consistent with iron binding
14643898 Recycling, degradation and sensitivity to the synergistic anion of transferrin in the receptor-independent route of iron uptake by human hepatoma (HuH-7) cells
14614458 holo-transferrin blocked apoptosis of N.1 cells that was induced by Myc-activation or by treatment with TNFalpha, FasL, and TRAIL
14580189 identification of C-lobe as binding site to receptor
14567694 examination of iron release to pyrophosphate from the isolated recombinant C-lobe and from that lobe in the intact protein, each free and bound to receptor
14523999 Observational study of genotype prevalence. (HuGE Navigator)
12951205 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12951205 Transferrin C1 homozygosity carriers had an increased risk of Alzheimer's in subjects > or =75 years of age, showing that homozygosity for the Transferrin C1 allele was associated with an approximately three-fold increased risk.
12942785 The analysis involved the data on nine polymorphic codominant loci: HP, GC, TF, PI, PGM1, GLO1, C3, ACP1, and ESD. The loci were selected by significance of differences in genotype frequencies between tuberculosis patients and healthy controls
12939601 Transferrin and other target genes identified may play a functional role in the downstream pathway of GADD153.
12884526 In the urban population, the loci TF (AvaI in exon5) and ACE (I/D polymorphism of the Alu repeat in intron16) were studied in 130 and 141 subjects.The polymorphic loci of the urban and rural populations did not differ in the allele frequencies
12819023 These findings demonstrate that papillary thyroid carcinoma cells synthesize unique post-translationally modified thyroglobulin and transferrin variants in situ.
12626412 analyses and comparison of the oligosaccharides present on the different isoforms of purified transferrin isolated from control and patients with severe alcohol abuse
12617162 review of role in bacterial infections, iron homeostasis, and free radical generation; and implications for theraputic use.
12473103 a complex of Yb3+-transferrin is recognized by human transferrin receptor, a possible pathway for Yb3+ accumulation in cells
12459033 E2 induces Tf gene expression through a nonconsensus distal ERE
12458193 The position of arginine 124 controls the rate of iron release from the N-lobe of the human protein.
12450380 The roles of the two basic residues in the "dilysine trigger" regions of transferrins have been clarified and their different behaviors compared to those of the lactoferrins.
12223217 a protein identical to or highly homologous with serum TF was purified from follicular fluid; follicular fluid transferrin significantly increased sperm motility
12207902 Binding patterns of vanadium ions with different valence states to human transferrin
12175089 Serum levels of soluble intercellular adhesion molecule-1 (sICAM-1), ceruloplasmin (Cp), and transferrin (Tf) in rheumatoid arthritis. Serum Tf levels were significantly diminished and serum levels of sICAM-1 and Cp were significantly increased.
12165535 high-capacity multivalent metal-inducible mechanism for Fe acquisition from transferrin and lactoferrin
12135367 differential effect of a his tag at the N- and C-termini: functional studies with recombinant human serum transferrin
12111369 Mutation 375glu-lys is predicted to cause a conformational change in the coiled region of the carboxyl-terminal iron-binding lobe.
12044175 A series of mutations in the carbonate-binding threonine and arginine residues of the N-terminal and C-terminal lobes of full-length transferrin (and in the N-lobe by itself) substantially alters the synergistic anion-binding functions of transferrin.
11940510 These results suggest that wild-type HFE negatively modulates the endocytic uptake of transferrin. This inhibitory effect is attenuated in cells expressing C282Y-mutant HFE.
11920219 Proband serum contains two transferrin forms: one of 80 kD analogous to the normal one, and a smaller one of 50 kD, which may arise from a specific degradation or be the gene product of a modified allele.
11903051 Solute carrier 11a1 (Slc11a1; formerly Nramp1) regulates metabolism and release of iron acquired by phagocytic, but not transferrin-receptor-mediated, iron uptake
11800564 mutational analysis of the transferrin receptor reveals overlapping HFE and transferrin binding sites
11785295 Observational study of gene-disease association. (HuGE Navigator)
11725818 Observational study of gene-disease association. (HuGE Navigator)
11703331 Observational study of gene-disease association. (HuGE Navigator)
11445282 Observational study of gene-disease association. (HuGE Navigator)
11436564 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRA      1 - 70
IAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTG     71 - 140
LGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGA    141 - 210
FKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKED    211 - 280
LIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC    281 - 350
PEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK    351 - 420
CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKI    421 - 490
NHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQN    491 - 560
TGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSN    561 - 630
VTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP      631 - 698
//

Text Mined References (306)

PMID Year Title
26852655 2016 Genome-wide association study of serum iron phenotypes in premenopausal women of European descent.
26392563 2015 Increased brain uptake of targeted nanoparticles by adding an acid-cleavable linkage between transferrin and the nanoparticle core.
26116962 2015 Retinoic acid inhibits tissue factor and HMGB1 via modulation of AMPK activity in TNF-? activated endothelial cells and LPS-injected mice.
26099594 2015 Role of augmented transferrin during the retraining for undeveloped left ventricle.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25914390 2015 Distribution of serum transferrin, and its associations with metabolic disorders among Chinese: A nation-wide, health and nutrition survey.
25809685 2015 Common Variants and Haplotypes in the TF, TNF-?, and TMPRSS6 Genes Are Associated with Iron Status in a Female Black South African Population.
25716754 2015 Identification of reduction-susceptible disulfide bonds in transferrin by differential alkylation using O(16)/O(18) labeled iodoacetic acid.
25635054 2015 CD81 promotes both the degradation of transferrin receptor 2 (TfR2) and the Tfr2-mediated maintenance of hepcidin expression.
25486930 2015 Hereditary hypotransferrinemia can lead to elevated transferrin saturation and, when associated to HFE or HAMP mutations, to iron overload.
25457201 2015 Genome-wide association study identifies TF as a significant modifier gene of iron metabolism in HFE hemochromatosis.
25375118 2014 Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis.
25352340 2014 Novel loci affecting iron homeostasis and their effects in individuals at risk for hemochromatosis.
25298206 2015 The adipokine apelin-13 induces expression of prothrombotic tissue factor.
25287020 2014 Maternal iron metabolism gene variants modify umbilical cord blood lead levels by gene-environment interaction: a birth cohort study.
25224454 2015 Genome-wide admixture and association study of serum iron, ferritin, transferrin saturation and total iron binding capacity in African Americans.
25163484 2014 Mycobacterium tuberculosis acquires iron by cell-surface sequestration and internalization of human holo-transferrin.
25000850 2015 Novel pathway for iron deficiency in pediatric non-alcoholic steatohepatitis.
24972167 2014 Binding of [Cr(phen)3](3+) to transferrin at extracellular and endosomal pHs: potential application in photodynamic therapy.
24599423 2014 From tissue iron retention to low systemic haemoglobin levels, new pathophysiological biomarkers of human abdominal aortic aneurysm.
24350254 2013 Polymorphism of the transferrin gene in eye diseases: keratoconus and Fuchs endothelial corneal dystrophy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256706 2014 Hypertension increases urinary excretion of immunoglobulin G, ceruloplasmin and transferrin in normoalbuminuric patients with type 2 diabetes mellitus.
23888904 2013 Two novel missense mutations in iron transport protein transferrin causing hypochromic microcytic anaemia and haemosiderosis: molecular characterization and structural implications.
23875541 2013 BMI but not stage or etiology of nonalcoholic liver disease affects the diagnostic utility of carbohydrate-deficient transferrin.
23817740 2013 Neuroimaging, nutrition, and iron-related genes.
23588470 Intronic SNP rs3811647 of the human transferrin gene modulates its expression in hepatoma cells.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23256035 2012 Iron and bismuth bound human serum transferrin reveals a partially-opened conformation in the N-lobe.
23089144 2013 An association of transferrin gene polymorphism and serum transferrin levels with age-related macular degeneration.
23027680 2012 Relationship between carbohydrate-deficient transferrin, gamma-glutamyl transferase, and mean corpuscular volume levels and alcohol-related brain volume decreases in male drinkers.
22938499 2012 Subcellular localization of tissue factor and human coronary artery smooth muscle cell migration.
22923205 2012 The effect of occupational lead exposure on blood levels of zinc, iron, copper, selenium and related proteins.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22873711 2012 Molecular dynamics simulations of iron- and aluminum-loaded serum transferrin: protonation of Tyr188 is necessary to prompt metal release.
22861364 2012 The immunobiology of apotransferrin in type 1 diabetes.
22829284 2012 Bovine prolactin elevates hTF expression directed by a tissue-specific goat ?-casein promoter through prolactin receptor-mediated STAT5a activation.
22819264 2012 Carbon monoxide (CO)-releasing molecule-derived CO regulates tissue factor and plasminogen activator inhibitor type 1 in human endothelial cells.
22726553 2012 The adipokine visfatin induces tissue factor expression in human coronary artery endothelial cells: another piece in the adipokines puzzle.
22722730 2012 Transferrin polymorphism and opportunistic infections in HIV-infected women in Rwanda.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22458330 2012 Involvement of multiple distinct Bordetella receptor proteins in the utilization of iron liberated from transferrin by host catecholamine stress hormones.
22424853 2012 Lower tissue factor inhibition in patients with ST segment elevation than in patients with non ST elevation acute myocardial infarction.
22356162 2012 Structure-based mutagenesis reveals critical residues in the transferrin receptor participating in the mechanism of pH-induced release of iron from human serum transferrin.
22343719 2012 The structural basis of transferrin sequestration by transferrin-binding protein B.
22327295 2012 Structural basis for iron piracy by pathogenic Neisseria.
22323359 2012 TMPRSS6, but not TF, TFR2 or BMP2 variants are associated with increased risk of iron-deficiency anemia.
22232660 2012 Brain structure in healthy adults is related to serum transferrin and the H63D polymorphism in the HFE gene.
22191507 2012 Ionic residues of human serum transferrin affect binding to the transferrin receptor and iron release.
22159020 2012 Retinal function and structure in the hypotransferrinemic mouse.
22041858 2011 Titanium preferential binding sites in human serum transferrin at physiological concentrations.
21904748 2011 Metal retention in human transferrin: consequences of solvent composition in analytical sample preparation methods.
21881004 2011 Na+/H+ exchanger isoform 6 (NHE6/SLC9A6) is involved in clathrin-dependent endocytosis of transferrin.
21873562 2011 Elevated transferrin saturation and risk of diabetes: three population-based studies.
21866866 2011 Gene diversity for haptoglobin and transferrin classical markers among Hindu and Muslim populations of Aligarh City, India.
21820158 2011 Circulating activated factor XI and active tissue factor as predictors of worse prognosis in patients following ischemic cerebrovascular events.
21811575 2011 Experimental meningococcal sepsis in congenic transgenic mice expressing human transferrin.
21788477 2011 How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
21785125 2011 Association of HFE and TMPRSS6 genetic variants with iron and erythrocyte parameters is only in part dependent on serum hepcidin concentrations.
21678080 2011 Competitive binding of Fe3+, Cr3+, and Ni2+ to transferrin.
21665994 2011 Genome-wide association study identifies two loci strongly affecting transferrin glycosylation.
21664032 2011 Microparticles (MPs), tissue factor (TF) and tissue factor inhibitor (TFPI) in cord blood plasma. A preliminary study and literature survey of procoagulant properties of MPs.
21643746 2012 HFE mutations and transferrin C1/C2 polymorphism among Croatian patients with schizophrenia and schizoaffective disorder.
21514009 2012 Effects of hemochromatosis and transferrin gene mutations on iron dyshomeostasis, liver dysfunction and on the risk of Alzheimer's disease.
21483845 2011 Genome-wide association study identifies genetic loci associated with iron deficiency.
21459485 2012 A unique N-glycan on human transferrin in CSF: a possible biomarker for iNPH.
21422745 2011 The A Allele of the -576G>A polymorphism of the transferrin gene is associated with the increased risk of age-related macular degeneration in smokers.
21408069 2011 Decreased CSF transferrin in sCJD: a potential pre-mortem diagnostic test for prion disorders.
21389980 2011 Gender and iron genes may modify associations between brain iron and memory in healthy aging.
21384276 2011 Association study between four polymorphisms in the HFE, TF and TFR genes and Parkinson's disease in southern Italy.
21376789 2011 The impact of highly hydrophobic material on the structure of transferrin and its ability to bind iron.
21320285 2011 Glycogen synthase kinase-3 negatively regulates tissue factor expression in monocytes interacting with activated platelets.
21269460 2011 Initial characterization of the human central proteome.
21208937 2011 Identification of a common variant in the TFR2 gene implicated in the physiological regulation of serum iron levels.
21113232 2010 Apotransferrin-induced recovery after hypoxic/ischaemic injury on myelination.
21049900 2010 In vitro interaction between ceruloplasmin and human serum transferrin.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20817350 2012 Transferrin and HFE genes interact in Alzheimer's disease risk: the Epistasis Project.
20738776 2011 Transferrin saturation as a predictor of hepatic iron overload.
20721554 2011 Dysmetabolic hyperferritinemia is associated with normal transferrin saturation, mild hepatic iron overload, and elevated hepcidin.
20708639 2010 Investigation on the interaction between tamoxifen and human holo-transferrin: determination of the binding mechanism by fluorescence quenching, resonance light scattering and circular dichroism methods.
20659343 2010 HFE gene variants modify the association between maternal lead burden and infant birthweight: a prospective birth cohort study in Mexico City, Mexico.
20634490 2010 Transferrin receptor 2 and HFE regulate furin expression via mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/Erk) signaling. Implications for transferrin-dependent hepcidin regulation.
20633231 2010 Delineating the regions of human transferrin involved in interactions with transferrin binding protein B from Neisseria meningitidis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615872 2010 Human transferrin confers serum resistance against Bacillus anthracis.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20447458 2010 Expression, purification, and characterization of recombinant human transferrin from rice (Oryza sativa L.).
20444258 2010 Gender differences of polymorphisms in the TF and TFPI genes, as related to phenotypes in patients with coronary heart disease and type-2 diabetes.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
20410508 2010 Hematopoietic and nonhematopoietic cell tissue factor activates the coagulation cascade in endotoxemic mice.
20397659 2010 Identification of a kinetically significant anion binding (KISAB) site in the N-lobe of human serum transferrin.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20371432 2010 Relationship between serum acute-phase proteins and high disease activity in patients with rheumatoid arthritis.
20309589 2012 Modulation of tissue factor and thrombomodulin expression in human aortic endothelial cells incubated with high glucose.
20215856 2010 Genetic association of angiogenesis- and hypoxia-related gene polymorphisms with osteonecrosis of the femoral head.
20202662 2010 Ebola virus uses clathrin-mediated endocytosis as an entry pathway.
20188707 2010 Human MRCKalpha is regulated by cellular iron levels and interferes with transferrin iron uptake.
20164577 2010 Prevalent iron metabolism gene variants associated with increased brain ferritin iron in healthy older men.
20150920 2010 A functional polymorphism (-603A --> G) in the tissue factor gene promoter is associated with adult-onset asthma.
20118108 Use of carbohydrate-deficient transferrin (CDT) and a combination of GGT and CDT (GGT-CDT) to assess heavy alcohol consumption in traffic medicine.
20113254 2010 Tissue factor +5466A>G and -1208D>I genetic polymorphisms and severity of rheumatoid arthritis.
20096706 2010 Characterization of the interaction between diferric transferrin and transferrin receptor 2 by functional assays and atomic force microscopy.
20066543 2010 Levels of transferrin in bronchoalveolar lavage fluid in sarcoidosis.
20064616 2010 Properties of a homogeneous C-lobe prepared by introduction of a TEV cleavage site between the lobes of human transferrin.
20052609 2010 Association of existing and new candidate genes for anxiety, depression and personality traits in older people.
20029940 2010 Suggestive synergy between genetic variants in TF and HFE as risk factors for Alzheimer's disease.
19921860 2009 Contrasting synergistic anion effects in vanadium(V) binding to nicatransferrin versus human serum transferrin.
19917294 2010 The unique kinetics of iron release from transferrin: the role of receptor, lobe-lobe interactions, and salt at endosomal pH.
19916167 2010 Excited-state lifetime studies of the three tryptophan residues in the N-lobe of human serum transferrin.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19859668 2010 Absence of binding between the human transferrin receptor and the transferrin complex of biological toxic trace element, aluminum, because of an incomplete open/closed form of the complex.
19856410 2010 Tissue factor -1208D>I polymorphism is associated with D-dimer levels in patients with inflammatory bowel disease.
19852572 2009 Lack of association between the C2 allele of transferrin and age-related macular degeneration in the Israeli population.
19838776 2009 Computational structure models of apo and diferric transferrin-transferrin receptor complexes.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19828835 2009 The role of transferrin receptor 1 and 2 in transferrin-bound iron uptake in human hepatoma cells.
19761807 2010 Human growth hormone-transferrin fusion protein for oral delivery in hypophysectomized rats.
19698254 2009 [Correlation analysis of tissue factor promotor polymorphism -1208I/D and venous thromboembolism].
19693784 A loop in the N-lobe of human serum transferrin is critical for binding to the transferrin receptor as revealed by mutagenesis, isothermal titration calorimetry, and epitope mapping.
19670106 2009 Diurnal changes in urinary excretion of IgG, transferrin, and ceruloplasmin depend on diurnal changes in systemic blood pressure in normotensive, normoalbuminuric type 2 diabetic patients.
19664057 2009 Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro.
19650928 2009 The association of biomarkers of iron status with peripheral arterial disease in US adults.
19583819 2009 Tissue factor gene polymorphisms and haplotypes and the risk of ischemic vascular events: four studies and a meta-analysis.
19572083 2009 Tissue factor +5466A>G polymorphism predicts plasma TF levels in subjects with cryptogenic ischaemic stroke.
19545871 2009 Tissue factor genetic polymorphisms and haplotypes in Japanese population.
19515372 2009 Tissue factor gene promoter haplotype associates with carotid intima-media thickness in subjects in cardiovascular risk prevention.
19290554 2009 Human serum transferrin: a tale of two lobes. Urea gel and steady state fluorescence analysis of recombinant transferrins as a function of pH, time, and the soluble portion of the transferrin receptor.
19281173 2009 Inequivalent contribution of the five tryptophan residues in the C-lobe of human serum transferrin to the fluorescence increase when iron is released.
19254567 2009 Interaction of the hereditary hemochromatosis protein HFE with transferrin receptor 2 is required for transferrin-induced hepcidin expression.
19250966 2009 A novel transferrin/TfR2-mediated mitochondrial iron transport system is disrupted in Parkinson's disease.
19228837 2009 Ceruloplasmin/Transferrin system is related to clinical status in acute stroke.
19219998 2009 Structural and functional consequences of the substitution of glycine 65 with arginine in the N-lobe of human transferrin.
19176989 2008 Tissue factor and cancer.
19165391 2009 Iron metabolism genes, low-level lead exposure, and QT interval.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19021568 2008 Kinetics and thermodynamics of metal-loaded transferrins: transferrin receptor 1 interactions.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18835036 2009 Transferrin induces interleukin-18 expression in chronic myeloid leukemia cell line, K-562.
18830724 2009 Assessment of Alzheimer's disease case-control associations using family-based methods.
18813964 2009 Alzheimer's disease risk variants show association with cerebrospinal fluid amyloid beta.
18795173 2008 Variants in iron metabolism genes predict higher blood lead levels in young children.
18654083 2008 Sugar chains of cerebrospinal fluid transferrin as a new biological marker of Alzheimer's disease.
18597674 2008 Differential transferrin expression in placentae from normal and abnormal pregnancies: a pilot study.
18509548 2008 The protective role of transferrin in Müller glial cells after iron-induced toxicity.
18442477 2008 Atypical serum transferrin isoform distribution in liver cirrhosis studied by HPLC, capillary electrophoresis and transferrin genotyping.
18395717 2009 The impact of hemochromatosis mutations and transferrin genotype on gonadotropin serum levels in infertile men.
18353773 2008 A novel sorting nexin modulates endocytic trafficking and alpha-secretase cleavage of the amyloid precursor protein.
18353247 2008 HFE association with transferrin receptor 2 increases cellular uptake of transferrin-bound iron.
18344013 2008 Genetic variants of transferrin in cystic fibrosis.
18307987 2008 Change in transferrin sialylation is a potential prognostic marker for severity of acute pancreatitis.
18257091 2008 ProApolipoprotein A1: a serum marker of brain metastases in lung cancer patients.
18245657 2008 New TFR2 mutations in young Italian patients with hemochromatosis.
18097132 2007 A new case of human atransferrinemia with a previously undescribed mutation in the transferrin gene.
18067952 2008 Changes in tissue factor and the effects of tissue factor pathway inhibitor on transient focal cerebral ischemia in rats.
18045615 2008 Polymorphisms of Transferrin gene are associated with schizophrenia in Chinese Han population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18022819 2008 Neither human hephaestin nor ceruloplasmin forms a stable complex with transferrin.
17980706 2008 Influence of alcohol use, ethnicity, age, gender, BMI and smoking on the serum transferrin glycoform pattern: implications for use of carbohydrate-deficient transferrin (CDT) as alcohol biomarker.
17976429 2007 Biological variability of transferrin saturation and unsaturated iron-binding capacity.
17728504 2007 Carbohydrate-deficient transferrin as a marker of heavy drinking in Korean males.
17711300 2007 Intrinsic fluorescence reports a global conformational change in the N-lobe of human serum transferrin following iron release.
17640392 2007 siRNA screen of the human signaling proteome identifies the PtdIns(3,4,5)P3-mTOR signaling pathway as a primary regulator of transferrin uptake.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17573378 Relationship between serum sialic acid and sialylated glycoproteins in alcoholics.
17496814 2007 Association study between the transferrin gene and schizophrenia in the Japanese population.
17206377 2007 The G277S transferrin mutation does not affect iron absorption in iron deficient women.
17192785 2007 Systematic meta-analyses of Alzheimer disease genetic association studies: the AlzGene database.
17119318 2007 Differential gene expression during development in two oligodendroglial cell lines overexpressing transferrin: a cDNA array analysis.
17116317 2007 Susceptibility groups for Alzheimer's disease (OPTIMA cohort): integration of gene variants and biochemical factors.
17047092 2006 Iron genes, iron load and risk of Alzheimer's disease.
17011669 2007 Genes related to iron metabolism and susceptibility to Alzheimer's disease in Basque population.
17008590 2006 Tissue factor and coagulation factor VII levels during acute myocardial infarction: association with genotype and adverse events.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16564538 2006 The mechanism of iron release from the transferrin-receptor 1 adduct.
16538641 2006 Serum level of sialic acid (SA) and carbohydrate-deficient transferrin (CDT) in type 2 diabetes mellitus with microvascular complications.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16497717 2006 Alveolar type I cells protect rat lung epithelium from oxidative injury.
16373913 2006 Increased urinary excretions of immunoglobulin g, ceruloplasmin, and transferrin predict development of microalbuminuria in patients with type 2 diabetes.
16339299 2006 Febrile-range temperature but not heat shock augments the acute phase response to interleukin-6 in human hepatoma cells.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16331960 2005 Differential susceptibility of transferrin glycoforms to chymotrypsin: a proteomics approach to the detection of carbohydrate-deficient transferrin.
16300393 2005 Composition of pH-sensitive triad in C-lobe of human serum transferrin. Comparison to sequences of ovotransferrin and lactoferrin provides insight into functional differences in iron release.
16288727 2005 Cell-mediated LDL oxidation: the impact of transition metals and transferrin.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
16195351 2005 Rab15 effector protein: a novel protein for receptor recycling from the endocytic recycling compartment.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16085060 2005 Aluminum exposure affects transferrin-dependent and -independent iron uptake by K562 cells.
16047113 2005 Association study of the G258S transferrin gene polymorphism and Parkinson's disease in the Spanish population.
15975770 2005 The C2 variant of human serum transferrin retains the iron binding properties of the native protein.
15924420 2005 Mutational analysis of C-lobe ligands of human serum transferrin: insights into the mechanism of iron release.
15892129 2005 Overexpression of human transferrin in two oligodendroglial cell lines enhances their differentiation.
15880641 2005 Transferrin receptor co-localizes and interacts with the hemochromatosis factor (HFE) and the divalent metal transporter-1 (DMT1) in trophoblast cells.
15698609 2005 Soluble transferrin receptor and mutations in hemochromatosis and transferrin genes in a general Catalan population.
15648851 2004 Phenotype and allele frequencies of some serum protein polymorphisms in populations of the Balkans.
15634274 2005 The first epidermal growth factor-like domains of factor Xa and factor IXa are important for the activation of the factor VII--tissue factor complex.
15536627 2004 Site-specific carbohydrate profiling of human transferrin by nano-flow liquid chromatography/electrospray ionization mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466165 2004 Molecular characterization of a third case of human atransferrinemia.
15327995 2004 The low pKa value of iron-binding ligand Tyr188 and its implication in iron release and anion binding of human transferrin.
15319290 2004 Diferric transferrin regulates transferrin receptor 2 protein stability.
15292400 2004 Alfy, a novel FYVE-domain-containing protein associated with protein granules and autophagic membranes.
15271890 2004 Cleavage of human transferrin by Porphyromonas gingivalis gingipains promotes growth and formation of hydroxyl radicals.
15229288 2004 Over-expression of Rififylin, a new RING finger and FYVE-like domain-containing protein, inhibits recycling from the endocytic recycling compartment.
15214510 2004 Biochemical model for inflammation of the brain: the effect of iron and transferrin on monocytes and lipid peroxidation.
15214509 2004 5- and 6-glycosylation of transferrin in patients with Alzheimer's disease.
15111541 2004 Parallel increase in urinary excretion rates of immunoglobulin G, ceruloplasmin, transferrin, and orosomucoid in normoalbuminuric type 2 diabetic patients.
15084671 2004 A proteomic analysis of human bile.
15060098 2004 Synergy between the C2 allele of transferrin and the C282Y allele of the haemochromatosis gene (HFE) as risk factors for developing Alzheimer's disease.
15042587 2004 Apotransferrin promotes the differentiation of two oligodendroglial cell lines.
14980223 2004 Structure of the human transferrin receptor-transferrin complex.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14757931 2003 Transferrin C2 variant does confer a risk for Alzheimer's disease in caucasians.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645044 2003 A computational study of the open and closed forms of the N-lobe human serum transferrin apoprotein.
14643898 2004 Recycling, degradation and sensitivity to the synergistic anion of transferrin in the receptor-independent route of iron uptake by human hepatoma (HuH-7) cells.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14614458 2003 Transferrin ensures survival of ovarian carcinoma cells when apoptosis is induced by TNFalpha, FasL, TRAIL, or Myc.
14580189 2003 Structural reorganization of the transferrin C-lobe and transferrin receptor upon complex formation: the C-lobe binds to the receptor helical domain.
14567694 2003 Iron release from transferrin, its C-lobe, and their complexes with transferrin receptor: presence of N-lobe accelerates release from C-lobe at endosomal pH.
14523999 2003 Genetic diversity of serum proteins in three subpopulations of the Maria Gond tribe of Madhya Pradesh, India.
12951205 2003 Association study between late-onset Alzheimer's disease and the transferrin gene polymorphisms in Chinese.
12942785 2003 [The use of discrete characters in discriminant analysis for diagnosis of pulmonary tuberculosis and for classification of patients differing in treatment efficiency based on polymorphisms at nine codominant loci-HP, GC, TF, PI, PGM1, GLO1, C3, ACP1 and ESD].
12939601 2003 Transcriptional regulation of the human transferrin gene by GADD153 in hepatoma cells.
12884526 2003 [Correlation between polymorphic variants of the genes for transferrin and angiotensin-converting enzyme and antioxidant activity of blood plasma].
12857860 2003 Myo6 facilitates the translocation of endocytic vesicles from cell peripheries.
12819023 2003 Proteomic and postproteomic characterization of keratan sulfate-glycanated isoforms of thyroglobulin and transferrin uniquely elaborated by papillary thyroid carcinomas.
12704209 2003 Co-localization of the mammalian hemochromatosis gene product (HFE) and a newly identified transferrin receptor (TfR2) in intestinal tissue and cells.
12626412 2003 The effects of ethanol on the glycosylation of human transferrin.
12617162 2002 Function and therapeutic development of apotransferrin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473103 2002 Complexation of ytterbium to human transferrin and its uptake by K562 cells.
12459033 2002 Estrogen regulation of transferrin gene expression in MCF-7 human breast cancer cells.
12458193 2003 The position of arginine 124 controls the rate of iron release from the N-lobe of human serum transferrin. A structural study.
12450380 2002 "Dilysine trigger" in transferrins probed by mutagenesis of lactoferrin: crystal structures of the R210G, R210E, and R210L mutants of human lactoferrin.
12223217 2002 Presence of alpha1-antitrypsin and transferrin in human follicular fluid--correlation with fertilization.
12210842 2002 Molecular mechanisms involved in the actions of apotransferrin upon the central nervous system: Role of the cytoskeleton and of second messengers.
12207902 2002 Binding patterns of vanadium ions with different valence states to human serum transferrin studied by HPLC/high-resolution ICP-MS.
12175089 2002 Levels of antioxidant proteins and soluble intercellular adhesion molecule-1 in serum of patients with rheumatoid arthritis.
12165535 2002 Multivalent metal-induced iron acquisition from transferrin and lactoferrin by myeloid cells.
12145410 2002 Apotransferrin decreases migration and enhances differentiation of oligodendroglial progenitor cells in an in vitro system.
12111369 2002 Molecular analysis of the transferrin gene in a patient with hereditary hypotransferrinemia.
11940510 2002 Regulation of transferrin-induced endocytosis by wild-type and C282Y-mutant HFE in transfected HeLa cells.
11903051 2002 Solute carrier 11a1 (Slc11a1; formerly Nramp1) regulates metabolism and release of iron acquired by phagocytic, but not transferrin-receptor-mediated, iron uptake.
11800564 2001 Mutational analysis of the transferrin receptor reveals overlapping HFE and transferrin binding sites.
11785295 2001 [Analysis of heterozygosity levels at P1,TF, PGM1, ACP1, HP, GC, GLO, C3, and ESD loci in pulmonary tuberculosis patients with different treatment outcomes].
11749962 2001 Transferrin binds insulin-like growth factors and affects binding properties of insulin-like growth factor binding protein-3.
11725818 2001 Neither the butyrylcholinesterase K variant nor transferrin C2 variant confers a risk for Alzheimer's disease in Koreans.
11703331 2001 Human transferrin G277S mutation: a risk factor for iron deficiency anaemia.
11702220 2001 Identification of 96 single nucleotide polymorphisms in eight genes involved in iron metabolism: efficiency of bioinformatic extraction compared with a systematic sequencing approach.
11606717 2001 Megalin-dependent cubilin-mediated endocytosis is a major pathway for the apical uptake of transferrin in polarized epithelia.
11445282 2001 Transferrin C2 variant does not confer a risk for Alzheimer's disease in Koreans.
11436564 2001 [Genetic predisposition to development of toxic liver cirrhosis caused by alcohol].
11297622 2001 Transferrin is an insulin-like growth factor-binding protein-3 binding protein.
11208127 2000 Truncated brush border myosin I affects membrane traffic in polarized epithelial cells.
11110675 2000 Molecular characterization of a case of atransferrinemia.
11027676 2000 Comparison of the interactions of transferrin receptor and transferrin receptor 2 with transferrin and the hereditary hemochromatosis protein HFE.
10931525 2000 Alternative splicing prevents transferrin secretion during differentiation of a human oligodendrocyte cell line.
10029548 1999 X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32.
9990067 1999 Association of HFE protein with transferrin receptor in crypt enterocytes of human duodenum.
9803271 1998 Identification of a mutation (A1879G) of transferrin from cDNA prepared from peripheral blood cells.
9760232 1998 Ligand-induced conformational change in transferrins: crystal structure of the open form of the N-terminal half-molecule of human transferrin.
9609685 1998 Two high-resolution crystal structures of the recombinant N-lobe of human transferrin reveal a structural change implicated in iron release.
9570576 1998 Intracellular and surface expression of the HIV-1 coreceptor CXCR4/fusin on various leukocyte subsets: rapid internalization and recycling upon activation.
9546397 1998 Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor.
9465039 1998 The hemochromatosis gene product complexes with the transferrin receptor and lowers its affinity for ligand binding.
9358047 1997 Exon/intron structure of the human transferrin receptor gene.
9312001 1997 Promotion of transferrin folding by cyclic interactions with calnexin and calreticulin.
9272172 1997 Human transferrin (Tf): a single mutation at codon 570 determines Tf C1 or Tf C2 variant.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8499451 1993 Expression of glycosylated and nonglycosylated human transferrin in mammalian cells. Characterization of the recombinant proteins with comparison to three commercially available transferrins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7498159 1995 The major protein expression profile and two-dimensional protein database of human heart.
6953407 1982 The complete amino acid sequence of human serum transferrin.
6833213 1983 The primary structure of human serum transferrin. The structures of seven cyanogen bromide fragments and the assembly of the complete structure.
6690479 1984 Human granulocyte/pollen-binding protein. Recognition and identification as transferrin.
6585826 1984 Human transferrin: cDNA characterization and chromosomal localization.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
6322780 1984 Molecular cloning and sequence analysis of cDNA for human transferrin.
6268632 1981 Physical characterization of the transferrin receptor in human placentae.
5927288 1966 A chemical difference between human transferrins B2 and C.
5711079 1968 [Congenital atransferrinemia in a 11-month-old child].
5610700 1967 Human transferrins C and D-Chi: an amino acid difference.
3858812 1985 Organization of the human transferrin gene: direct evidence that it originated by gene duplication.
3786138 1986 The 5' region of the human transferrin gene: structure and potential regulatory sites.
3678832 1987 Complete structure of the human transferrin gene. Comparison with analogous chicken gene and human pseudogene.
3436225 1987 Chromosomal localization of ceruloplasmin and transferrin genes in laboratory rats, mice and in man by hybridization with specific DNA probes.
3106157 1986 The human transferrin gene: 5' region contains conserved sequences which match the control elements regulated by heavy metals, glucocorticoids and acute phase reaction.
3057819 1988 Transferrin: evolution and genetic regulation of expression.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.
2780570 1989 Changes in brain gene expression shared by scrapie and Alzheimer disease.
1932003 1991 Expression and initial characterization of five site-directed mutants of the N-terminal half-molecule of human transferrin.
1851757 1991 Sertoli cell-specific expression of the human transferrin gene. Comparison with the liver-specific expression.
1809186 1991 A cloned gene for human transferrin.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.