Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.63
PubTator Score 1.50

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 9.8e-05
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Gene RIF (1)

17091336 Identification of a novel gene, Tsc21, exclusively expressed in testes.

AA Sequence

QPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ                                  141 - 180

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17091336 2007 Identification and characteristics of a novel testis-specific gene, Tsc21, in mice and human.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.