Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

Synonym

Accession O43247 B1AH46 Q6ICF2 Q8IVQ2 Q9Y4V8
Symbols EAN57
C22orf33
cE81G9.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 HCA RNA Cell Line (3)

Protein-protein Interaction (7)

AA Sequence

MELGHGAGTTTFTRAHLNDKEGQQDLDPWKAAYSSLDTSKFKNQGLSSPQPLPLGASAQGSSLGQCHLKE      1 - 70
IPPPPPTAASRDSLGMDPQSRSLKNAGSRSSSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGS     71 - 140
IIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLF    141 - 210
RGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNLNLQKALEEKYGENSKSKSSKY    211 - 280
//

Text Mined References (5)

PMID Year Title