Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.16
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.8e-08
astrocytoma 1146 3.1e-03
glioblastoma 5792 2.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma 1.900 3.1e-03
glioblastoma 1.200 2.1e-02
ovarian cancer -1.100 1.8e-08

 GO Function (1)

AA Sequence

MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMI      1 - 70
GVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAF     71 - 140
FVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY                  141 - 196
//

Text Mined References (6)

PMID Year Title