Testis-expressed protein 22

Property Summary

NCBI Gene PubMed Count	1
PubMed Score	0.20

PubTator Score	0.17

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Testis 18,518

Nerve - Tibial 18,007

Ovary 17,971

Spleen 17,614

Brain - Cerebellum 17,983

Brain - Cerebellar Hemisphere 18,015

Prostate 18,213

Thyroid 18,024

Uterus 17,618

Brain - Spinal cord (cervical c-1) 17,973

Cells - EBV-transformed lymphocytes 18,186

Vagina 17,834

Small Intestine - Terminal Ileum 17,954

Cells - Transformed fibroblasts 17,577

Brain - Cortex 18,039

Brain - Amygdala 18,006

Breast - Mammary Tissue 18,103

Brain - Caudate (basal ganglia) 18,001

Brain - Nucleus accumbens (basal ganglia... 18,024

Adipose - Subcutaneous 18,110

Brain - Hippocampus 18,011

Brain - Frontal Cortex (BA9) 18,069

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Hypothalamus 18,169

Brain - Substantia nigra 17,981

Minor Salivary Gland 18,005

Brain - Putamen (basal ganglia) 17,863

Artery - Coronary 17,949

Lung 18,057

Pituitary 18,147

Colon - Sigmoid 18,089

Esophagus - Gastroesophageal Junction 18,000

Adipose - Visceral (Omentum) 17,937

Artery - Aorta 17,896

Kidney - Cortex 17,329

Adrenal Gland 18,071

Skin - Sun Exposed (Lower leg) 17,968

Esophagus - Muscularis 18,017

Esophagus - Mucosa 18,076

Skin - Not Sun Exposed (Suprapubic) 18,081

Artery - Tibial 17,631

Stomach 17,879

Whole Blood 17,439

Pancreas 18,123

Heart - Atrial Appendage 17,896

Colon - Transverse 17,825

Heart - Left Ventricle 18,006

Liver 18,071

Muscle - Skeletal 17,778

adipose tissue 15,837

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

duodenum 15,975

endometrium 16,349

epididymis 15,863

fallopian tube 16,245

gallbladder 16,333

kidney 15,917

lung 16,312

lymph node 15,833

ovary 15,408

parathyroid gland 14,769

placenta 15,937

prostate 16,460

seminal vesicle 15,918

skin 16,206

small intestine 16,154

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Placenta 3,079

See source...

See source...

Synonym

Accession	C9J3V5
Symbols

Gene

TEX22

Ortholog (3)

Species	Source	Disease
Mouse 16,567	Inparanoid OMA EggNOG
Rat 15,112	OMA EggNOG
Dog 15,069	Inparanoid OMA EggNOG

UniProt Keyword (4)

Complete proteome 20,231

Reference proteome 20,231

Cytoplasm 4,952

Cytoplasmic vesicle 535

GO Component (1)

acrosomal vesicle 89

Compartment GO Term (18)

Acrosomal vesicle 89

Cell 16,178

Cell part 16,177

Cytoplasm 10,983

Cytoplasmic part 9,247

Cytoplasmic vesicle 2,218

Endomembrane system 4,237

Intracellular 14,108

Intracellular organelle 12,025

Intracellular part 13,972

Intracellular vesicle 2,217

Organelle 12,238

Secretory granule 852

Secretory vesicle 970

Sperm part 150

See all...

GWAS Trait (3)

Exploratory eye movement dysfunction in ... 23

Exploratory eye movement dysfunction in ... 15

Exploratory eye movement dysfunction in ... 10

HCA RNA Cell Line (54)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

AA Sequence

MDSRKLSPRGKKLESHLSQEHRRPPLGLIAAWGQPSIQSSVQQGLQTQDWVCEPPERRRPGRRWSVSIDE      1 - 70
RRRLATLGGRERPGAAGTQLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNA     71 - 140
TFEASRSPPS                                                                141 - 150
//

Text Mined References (2)

Summary
Details

	PMID	Year	Title