Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDSRKLSPRGKKLESHLSQEHRRPPLGLIAAWGQPSIQSSVQQGLQTQDWVCEPPERRRPGRRWSVSIDE      1 - 70
RRRLATLGGRERPGAAGTQLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNA     71 - 140
TFEASRSPPS                                                                141 - 150
//

Text Mined References (2)

PMID Year Title