Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.47
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Bladder carcinoma 2 3.067 1.5

Expression

Synonym

Accession Q8NA77
Symbols

Gene

  Ortholog (1)

Species Source Disease
Rat EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAE      1 - 70
SEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDAD     71 - 140
WTQGLPWRFEELLTCSHWPSFFPS                                                  141 - 164
//

Text Mined References (9)

PMID Year Title