Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.27
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 3.5e-05
psoriasis 6685 5.0e-02
Disease Target Count Z-score Confidence
Azoospermia 89 3.657 1.8

Synonym

Accession Q9BXU2 Q5JYF6
Symbols TGC3B
TSGA5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MALRPEDPSSGFRHGNVVAFIIEKMARHTKGPEFYFENISLSWEEVEDKLRAILEDSEVPSEVKEACTWG      1 - 70
SLALGVRFAHRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQ     71 - 140
RERDMLRWKLFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEKEAVAAAGAAGGKGEERYAEAGPAP    141 - 210
AEVLQGLGGGFRQPLGAIVAGKLHLCGAEGERSQVSTNSHVCLLWAWVHSLTGASSCPAPYLIHILIPMP    211 - 280
FVRLLSHTQYTPFTSKGHRTGSNSDAFQLGGL                                          281 - 312
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
14531651 2003 Molecular and cytogenetic characterization of two azoospermic patients with X-autosome translocation.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.