Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.27
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.5e-05
psoriasis 6694 2.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Azoospermia 110 3.663 1.8

Synonym

Accession Q9BXU2 Q5JYF6
Symbols TGC3B
TSGA5

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MALRPEDPSSGFRHGNVVAFIIEKMARHTKGPEFYFENISLSWEEVEDKLRAILEDSEVPSEVKEACTWG      1 - 70
SLALGVRFAHRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQ     71 - 140
RERDMLRWKLFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEKEAVAAAGAAGGKGEERYAEAGPAP    141 - 210
AEVLQGLGGGFRQPLGAIVAGKLHLCGAEGERSQVSTNSHVCLLWAWVHSLTGASSCPAPYLIHILIPMP    211 - 280
FVRLLSHTQYTPFTSKGHRTGSNSDAFQLGGL                                          281 - 312
//

Text Mined References (3)

PMID Year Title