Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.60
PubTator Score 6.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IYF3 A8K8V6 Q5JQQ8 Q96LZ4 Q96M47 Q9BXU6
Symbols TGC1
TSGA3
SPGFX2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
26136358 Genetic screening of a large cohort of idiopathic infertile men reveals that TEX11 mutations, including frameshift and splicing acceptor site mutations, cause infertility in 1% of azoospermic men.
26136358 TEX11 mutations, including frameshift and splicing acceptor site mutations, cause infertility in 1% of non-obstructive azoospermic men.
25970010 hemizygous TEX11 mutations were a common cause of meiotic arrest and azoospermia in infertile men
20378615 Observational study of gene-disease association. (HuGE Navigator)
11279525 TEX11 was specifically expressed in human testis.

AA Sequence

MISAHCNLRLLCSSDSSASASQVAGTTEVVENLVTNDNSPNIPEAIDRLFSDIANINRESMAEITDIQIE      1 - 70
EMAVNLWNWALTIGGGWLVNEEQKIRLHYVACKLLSMCEASFASEQSIQRLIMMNMRIGKEWLDAGNFLI     71 - 140
ADECFQAAVASLEQLYVKLIQRSSPEADLTMEKITVESDHFRVLSYQAESAVAQGDFQRASMCVLQCKDM    141 - 210
LMRLPQMTSSLHHLCYNFGVETQKNNKYEESSFWLSQSYDIGKMDKKSTGPEMLAKVLRLLATNYLDWDD    211 - 280
TKYYDKALNAVNLANKEHLSSPGLFLKMKILLKGETSNEELLEAVMEILHLDMPLDFCLNIAKLLMDHER    281 - 350
ESVGFHFLTIIHERFKSSENIGKVLILHTDMLLQRKEELLAKEKIEEIFLAHQTGRQLTAESMNWLHNIL    351 - 420
WRQAASSFEVQNYTDALQWYYYSLRFYSTDEMDLDFTKLQRNMACCYLNLQQLDKAKEAVAEAERHDPRN    421 - 490
VFTQFYIFKIAVIEGNSERALQAIITLENILTDEESEDNDLVAERGSPTMLLSLAAQFALENGQQIVAEK    491 - 560
ALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAEMPESEDKKKEMDRLLTCLNRAFVKLSQPFGEEALSLES    561 - 630
RANEAQWFRKTAWNLAVQCDKDPVMMREFFILSYKMSQFCPSDQVILIARKTCLLMAVAVDLEQGRKAST    631 - 700
AFEQTMFLSRALEEIQTCNDIHNFLKQTGTFSNDSCEKLLLLYEFEVRAKLNDPLLESFLESVWELPHLE    701 - 770
TKTFETIAIIAMEKPAHYPLIALKALKKALLLYKKEEPIDISQYSKCMHNLVNLSVPDGASNVELCPLEE    771 - 840
VWGYFEDALSHISRTKDYPEMEILWLMVKSWNTGVLMFSRSKYASAEKWCGLALRFLNHLTSFKESYETQ    841 - 910
MNMLYSQLVEALSNNKGPVFHEHGYWSKSD                                            911 - 940
//

Text Mined References (14)

PMID Year Title
26136358 2015 TEX11 is mutated in infertile men with azoospermia and regulates genome-wide recombination rates in mouse.
25970010 2015 X-linked TEX11 mutations, meiotic arrest, and azoospermia in infertile men.
25416956 2014 A proteome-scale map of the human interactome network.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18369460 2008 ZIP4H (TEX11) deficiency in the mouse impairs meiotic double strand break repair and the regulation of crossing over.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.