Property Summary

NCBI Gene PubMed Count 65
PubMed Score 843.07
PubTator Score 166.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Protein-protein Interaction (1)

Gene RIF (59)

PMID Text
26791235 Identify of MLL-fusion/MYC dash, verticalmiR-26 dash, verticalTET1 signaling circuit in MLL-rearranged acute myeloid leukemia.
26711177 Here, the authors reveal the methylcytosine dioxygenases TET1 and TET2 as active regulators of CTCF-mediated alternative splicing through conversion of 5-methylcytosine to its oxidation derivatives.
26703470 these data show that hypoxia-inducible genes are regulated in a multilayered manner that includes epigenetic regulation via TETs and 5-hmC levels in addition to HIF stabilization.
26684294 our study demonstrated that DNA hypomethylation at the TET1 promoter was associated with childhood asthma in African Americans.
26546041 these data suggest a dual function of GADD45a in oxidative DNA demethylation, to promote directly or indirectly TET1 activity and to enhance subsequent 5-formylcytosine/5-carboxylcytosine removal.
26524525 crystal structures of TET2-5hmC-DNA and TET2-5fC-DNA complexes at 1.80 A and 1.97 A resolution, respectively
26376879 The downregulation of ALDOB could indicate a poor prognosis for HCC patients. In addition, ALDOB inhibits the invasive features of cell lines partly through TET1 expression.
26356709 rs3998860-G allele was significantly associated with the disease severity, suggesting an involvement of TET1 locus in the modulation of apoptosis and liver injury in Nonalcoholic Fatty Liver Disease.
26294212 Hypoxia deregulates TET1. TET1/3 levels were associated with tumor hypoxia, tumor malignancy, and poor prognosis in breast cancer patients. Coordinate functions of TET1 and TET3 were needed to activate TNFalpha-p38-MAPK signaling in hypoxia.
26207381 Our study indicates that early breast cancer patients with decreased expression of TET1 mRNA had worse overall survival.
26165803 Expression levels of TET1 are low in renal carcinoma, particularly in high grade tumors.
26136340 Noncovalent binding of ADP-ribose polymers with TET1 catalytic domain decreases TET1 hydroxylase activity while the covalent PARylation stimulates TET1 enzyme. In addition, TET1 activates PARP-1/ARTD1 independently of DNA breaks.
26063725 Aberrant TET1 Methylation is closely Associated with CpG Island Methylator Phenotype in Colorectal Cancer
26013976 expression in systemic sclerosis fibroblasts abnormally regulated in hypoxic environment and accompanied by global DNA hypomethylation
25925565 This study expands the knowledge about Tet1 involvement in stemness circuits in embryonic stem cells and provides evidence for a transcriptional relationship between Tet1 and Polycomb repressive complex 2 in adult proliferating cells.
25824049 conclude that miR-520b depresses proliferation of liver cancer cells through targeting 3'UTR of TET1 mRNA
25735355 Downregulation of TET1 due to hypermethylation is associated with breast cancer metastasis.
25568311 TET1, TET2, and TET3 are highly phosphorylated.
25517638 Findings show that TET1 serves as a transcription co-activator that interacts with HIF-1alpha and HIF-2alpha to enhance their transactivation activity as well as INSIG1 in addition to its role in demethylating 5-methylcytosine.
25476119 The expression (mRNA and protein levels) of DNMT1 and TET1 is increased in PFC of SZ and BP disorder patients.
25466250 Suppression of TET1-dependent DNA demethylation is critical for KRAS-mediated transformation.
25367851 Potentiation of TET1 expression was linked to hepatocellular carcinogenesis and disease progression.
25362856 Data indicate that tet oncogene 1 protein (TET1) silencing in primary epithelial colon cells increase their cellular proliferation.
25175940 TET1 partially mediates HDAC inhibitor elicited suppression of breast cancer invasion.
25089631 GABRA3 also carries a microRNA (miR-767) with predicted target sites in TET1 and TET3, two members of the ten-eleven-translocation family of tumor suppressor genes, involved in the conversion of 5-methylcytosines to 5-hydroxymethylcytosines in DNA.
24958354 TET1 depletion yields widespread reduction of 5hmC, while depletion of TET2 and TET3 reduces 5hmC at a subset of TET1 targets suggesting functional co-dependence.
24915579 These results indicate that IGF2BP1 and TET1/2 contribute to the stemness of MSCs, at least regarding their proliferative potential.
24875481 the results identify TET1 as a maintenance DNA demethylase that does not purposely decrease methylation levels, but specifically prevents aberrant methylation spreading into unmethylated CpG islands in differentiated cells.
24835990 Hypoxia results in transcriptional activation of TET1, and full induction of hypoxia-responsive genes and global 5-hmC increases require TET1.
24804542 TET1 suppresses cancer formation by coupling DNA demethylation with DNA-PK activation of p53 and suppression of oncogenic protein EZH2.
24743738 the mechanism underlying the acquisition of 5-fluorouracil resistance in colorectal cancer involves the upregulation of Nrf2 and HO-1 expression via epigenetic modifications of DNA demethylation.
24507562 Decrease in TET1 transcript and protein levels is associated with some clinicopathological features in gastric cancer.
24469454 5-hmC in human chondrocytes is suppressed by proinflammatory cytokines IL-1beta and TNF-alpha, and this suppression involves downregulation of TET1 and IDH expression and activity.
24325350 There was no statistical significance in TET1 rs150689919 genotype or allele frequencies between the PD cases and healthy controls, even after being stratified by gender and age at onset.
24323992 A MLL-TET1 translocation is described in a case of T-cell lymphoblastic lymphoma with subsequent switch to acute myelomonocytic myeloid leukemia.
23938174 This study demonistrated that the expressions of DNMT1 and TET1 are increased in patient with schizophrenia.
23820384 An miR-29a mimic consistently decreases Tet1 and Tet3 transcripts while the miR-29a inhibitor increases Tet1 and Tet3 levels consistent with a pattern of direct targeting.
23818607 TET1 plays an essential oncogenic role in MLL-rearranged leukemia.
23716660 Data indicate that the genes comprising the HMGA2-TET1-HOXA9 pathway are coordinately regulated in breast cancer and together encompass a prognostic signature for patient survival.
23685628 TET1-mediated 5-hydroxymethylcytosine modification could contribute to the epigenetic variation of induced pluripotent stem cells and induced pluripotent stem cell-human embryonic stem cell differences.
23671639 Data show 5-hydroxymethylcytosine (5 hmC) may be served as a prognostic marker for hepatocellular carcinoma (HCC) and the decreased expression of TET1 is likely one of the mechanisms underlying 5 hmC loss in HCC.
23328087 Results suggest a TET1-dependent anti-inflammatory pathway, which may include TET2. In particular, IL-1beta transcriptional regulation is likely to depend on TET1-regulated chromatin domains.
23213213 OAC1 increases transcription of the Oct4-Nanog-Sox2 triad and Tet1, a gene known to be involved in DNA demethylation
23100278 Data indicate that MLL-TET1 rearrangement was confirmed in 3 new cases of acute myeloid leukemia.
22999938 these results illustrate a mechanism by which TET1 suppresses tumor development and invasion partly through downregulation of critical gene methylation.
22948384 TET1 (mRNA and protein) is markedly increased (two- to threefold) in the parietal cortex of psychotic patients.
22688054 The loss of 5-hydroxymethylcytosine is a frequent event in gliomas, independent of IDH1 mutation, and may be influenced by the nuclear exclusion of TET1 from the nuclei of glioma cells.
22320381 These findings suggest that the amount of 5-hmC in tumors is often reduced via various mechanisms, including the downregulation of TET1.
21496894 Study suggests a TET1-induced oxidation-deamination mechanism for active DNA demethylation in mammals.
21311766 Different binding properties and function of CXXC zinc finger domains in Dnmt1 and Tet1.
21251613 The oncometabolite 2-hydroxyglutarate is a competitive inhibitor of multiple alpha-ketoglutarate-dependent dioxygenases, including histone demethylases, prolyl hydroxylases, and the TET family of 5-methlycytosine hydroxylases.
19923888 TET family influences DNA methylation in hematopoietic malignancy
19420352 mutational status of TET1, TET2, and TET3 in myeloproliferative neoplasms (MPNs), chronic myelomonocytic leukemia (CMML), and acute myeloid leukemia (AML)
19420352 Observational study of gene-disease association. (HuGE Navigator)
19372391 findings show TET1 catalyzes conversion of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC) in cultured cells & in vitro; TET proteins have potential roles in epigenetic regulation by modification of 5mC to hmC
18163421 Significant association with late-onset Alzheimer's disease for 4 SNPs: rs1881747 near DKK1, rs2279420 in ANK3, rs2306402 in CTNNA3, and rs5030882 in CXXC6 in 1,160 cases and 1,389 controls.
18163421 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
12646957 demonstrated that TET1 is fused to MLL in a case of pediatric acute myeloid leukemia containing the t(10;11)(q22;q23)

AA Sequence

MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKKKTEPKPPVPV      1 - 70
RSLLTRAGAARMNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPLVVAKSKKVPLSKGLEKQHDC     71 - 140
DYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSLLKGKSQETTQFWSQRVEDSKINIPTHSGPA    141 - 210
AEILPGPLEGTRCGEGLFSEETLNDTSGSPKMFAQDTVCAPFPQRATPKVTSQGNPSIQLEELGSRVESL    211 - 280
KLSDSYLDPIKSEHDCYPTSSLNKVIPDLNLRNCLALGGSTSPTSVIKFLLAGSKQATLGAKPDHQEAFE    281 - 350
ATANQQEVSDTTSFLGQAFGAIPHQWELPGADPVHGEALGETPDLPEIPGAIPVQGEVFGTILDQQETLG    351 - 420
MSGSVVPDLPVFLPVPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPP    421 - 490
VMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTT    491 - 560
VVTMPVPMVSTSSSSYTTLLPTLEKKKRKRCGVCEPCQQKTNCGECTYCKNRKNSHQICKKRKCEELKKK    561 - 630
PSVVVPLEVIKENKRPQREKKPKVLKADFDNKPVNGPKSESMDYSRCGHGEEQKLELNPHTVENVTKNED    631 - 700
SMTGIEVEKWTQNKKSQLTDHVKGDFSANVPEAEKSKNSEVDKKRTKSPKLFVQTVRNGIKHVHCLPAET    701 - 770
NVSFKKFNIEEFGKTLENNSYKFLKDTANHKNAMSSVATDMSCDHLKGRSNVLVFQQPGFNCSSIPHSSH    771 - 840
SIINHHASIHNEGDQPKTPENIPSKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQLSEAPSENSSP    841 - 910
SKSEKDEESEQRTASLLNSCKAILYTVRKDLQDPNLQGEPPKLNHCPSLEKQSSCNTVVFNGQTTTLSNS    911 - 980
HINSATNQASTKSHEYSKVTNSLSLFIPKSNSSKIDTNKSIAQGIITLDNCSNDLHQLPPRNNEVEYCNQ    981 - 1050
LLDSSKKLDSDDLSCQDATHTQIEEDVATQLTQLASIIKINYIKPEDKKVESTPTSLVTCNVQQKYNQEK   1051 - 1120
GTIQQKPPSSVHNNHGSSLTKQKNPTQKKTKSTPSRDRRKKKPTVVSYQENDRQKWEKLSYMYGTICDIW   1121 - 1190
IASKFQNFGQFCPHDFPTVFGKISSSTKIWKPLAQTRSIMQPKTVFPPLTQIKLQRYPESAEEKVKVEPL   1191 - 1260
DSLSLFHLKTESNGKAFTDKAYNSQVQLTVNANQKAHPLTQPSSPPNQCANVMAGDDQIRFQQVVKEQLM   1261 - 1330
HQRLPTLPGISHETPLPESALTLRNVNVVCSGGITVVSTKSEEEVCSSSFGTSEFSTVDSAQKNFNDYAM   1331 - 1400
NFFTNPTKNLVSITKDSELPTCSCLDRVIQKDKGPYYTHLGAGPSVAAVREIMENRYGQKGNAIRIEIVV   1401 - 1470
YTGKEGKSSHGCPIAKWVLRRSSDEEKVLCLVRQRTGHHCPTAVMVVLIMVWDGIPLPMADRLYTELTEN   1471 - 1540
LKSYNGHPTDRRCTLNENRTCTCQGIDPETCGASFSFGCSWSMYFNGCKFGRSPSPRRFRIDPSSPLHEK   1541 - 1610
NLEDNLQSLATRLAPIYKQYAPVAYQNQVEYENVARECRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNN   1611 - 1680
GSTVVCTLTREDNRSLGVIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPRRKKRTCFTQP   1681 - 1750
VPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSSLPTLGSNTETVQPEVKSETEPHF   1751 - 1820
ILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSG   1821 - 1890
ANAAAADGPGISQLGEVAPLPTLSAPVMEPLINSEPSTGVTEPLTPHQPNHQPSFLTSPQDLASSPMEED   1891 - 1960
EQHSEADEPPSDEPLSDDPLSPAEEKLPHIDEYWSDSEHIFLDANIGGVAIAPAHGSVLIECARRELHAT   1961 - 2030
TPVEHPNRNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNE   2031 - 2100
LNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV                                     2101 - 2136
//

Text Mined References (70)

PMID Year Title
26791235 2016 Identification of MLL-fusion/MYC?miR-26?TET1 signaling circuit in MLL-rearranged leukemia.
26711177 2016 TET-catalyzed oxidation of intragenic 5-methylcytosine regulates CTCF-dependent alternative splicing.
26703470 2016 Fumarate and Succinate Regulate Expression of Hypoxia-inducible Genes via TET Enzymes.
26684294 2016 Ten-eleven translocation 1 (TET1) methylation is associated with childhood asthma and traffic-related air pollution.
26546041 GADD45a physically and functionally interacts with TET1.
26524525 2015 Structural insight into substrate preference for TET-mediated oxidation.
26376879 2015 Aldolase B inhibits metastasis through Ten-Eleven Translocation 1 and serves as a prognostic biomarker in hepatocellular carcinoma.
26356709 2015 Epigenetic Modifications in the Biology of Nonalcoholic Fatty Liver Disease: The Role of DNA Hydroxymethylation and TET Proteins.
26294212 2015 Hypoxia Drives Breast Tumor Malignancy through a TET-TNF?-p38-MAPK Signaling Axis.
26207381 2015 Reduced Expression of TET1, TET2, TET3 and TDG mRNAs Are Associated with Poor Prognosis of Patients with Early Breast Cancer.
26165803 2015 Restored expression levels of TET1 decrease the proliferation and migration of renal carcinoma cells.
26136340 2015 5mC-hydroxylase activity is influenced by the PARylation of TET1 enzyme.
26063725 2015 Aberrant TET1 Methylation Closely Associated with CpG Island Methylator Phenotype in Colorectal Cancer.
26013976 2015 Global DNA hypomethylation and hypoxia-induced expression of the ten eleven translocation (TET) family, TET1, in scleroderma fibroblasts.
25925565 2015 TET1 is controlled by pluripotency-associated factors in ESCs and downmodulated by PRC2 in differentiated cells and tissues.
25824049 2015 MiR-520b suppresses proliferation of hepatoma cells through targeting ten-eleven translocation 1 (TET1) mRNA.
25735355 2015 Hypermethylation of TET1 promoter is a new diagnosic marker for breast cancer metastasis.
25568311 2015 Phosphorylation of TET proteins is regulated via O-GlcNAcylation by the O-linked N-acetylglucosamine transferase (OGT).
25517638 2014 TET1 regulates hypoxia-induced epithelial-mesenchymal transition by acting as a co-activator.
25476119 2015 DNA-methyltransferase1 (DNMT1) binding to CpG rich GABAergic and BDNF promoters is increased in the brain of schizophrenia and bipolar disorder patients.
25466250 2014 Suppression of TET1-dependent DNA demethylation is essential for KRAS-mediated transformation.
25367851 2014 Negative feedback of miR-29 family TET1 involves in hepatocellular cancer.
25362856 2015 TET1 is a tumour suppressor that inhibits colon cancer growth by derepressing inhibitors of the WNT pathway.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
25175940 2014 TET1 partially mediates HDAC inhibitor-induced suppression of breast cancer invasion.
25089631 2014 A novel cancer-germline transcript carrying pro-metastatic miR-105 and TET-targeting miR-767 induced by DNA hypomethylation in tumors.
24958354 2014 Distinct and overlapping control of 5-methylcytosine and 5-hydroxymethylcytosine by the TET proteins in human cancer cells.
24915579 2014 IGF2BP1 expression in human mesenchymal stem cells significantly affects their proliferation and is under the epigenetic control of TET1/2 demethylases.
24875481 2014 TET1 is a maintenance DNA demethylase that prevents methylation spreading in differentiated cells.
24835990 2014 TET1-mediated hydroxymethylation facilitates hypoxic gene induction in neuroblastoma.
24804542 2014 TET1 exerts its tumor suppressor function by interacting with p53-EZH2 pathway in gastric cancer.
24743738 2014 Epigenetic modification of Nrf2 in 5-fluorouracil-resistant colon cancer cells: involvement of TET-dependent DNA demethylation.
24507562 2014 Decreased expression of ten-eleven translocation 1 protein is associated with some clinicopathological features in gastric cancer.
24469454 2014 Modulation of ten-eleven translocation 1 (TET1), Isocitrate Dehydrogenase (IDH) expression, ?-Ketoglutarate (?-KG), and DNA hydroxymethylation levels by interleukin-1? in primary human chondrocytes.
24325350 2013 Association study between SNP rs150689919 in the DNA demethylation gene, TET1, and Parkinson's disease in Chinese Han population.
24323992 2013 First description of the t(10;11)(q22;q23)/MLL-TET1 translocation in a T-cell lymphoblastic lymphoma, with subsequent lineage switch to acute myelomonocytic myeloid leukemia.
23938174 2013 DNA-methylation gene network dysregulation in peripheral blood lymphocytes of schizophrenia patients.
23820384 2013 Ten-eleven translocation (Tet) and thymine DNA glycosylase (TDG), components of the demethylation pathway, are direct targets of miRNA-29a.
23818607 2013 TET1 plays an essential oncogenic role in MLL-rearranged leukemia.
23716660 2013 HMGA2/TET1/HOXA9 signaling pathway regulates breast cancer growth and metastasis.
23685628 2013 Subtelomeric hotspots of aberrant 5-hydroxymethylcytosine-mediated epigenetic modifications during reprogramming to pluripotency.
23671639 2013 Decrease of 5-hydroxymethylcytosine is associated with progression of hepatocellular carcinoma through downregulation of TET1.
23328087 2013 TET1 is a negative transcriptional regulator of IL-1? in the THP-1 cell line.
23213213 2012 Identification of Oct4-activating compounds that enhance reprogramming efficiency.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23100278 2013 Genomic breakpoints and clinical features of MLL-TET1 rearrangement in acute leukemias.
22999938 2012 TET1 suppresses cancer invasion by activating the tissue inhibitors of metalloproteinases.
22948384 2012 Upregulation of TET1 and downregulation of APOBEC3A and APOBEC3C in the parietal cortex of psychotic patients.
22688054 2012 Nuclear exclusion of TET1 is associated with loss of 5-hydroxymethylcytosine in IDH1 wild-type gliomas.
22320381 2012 Loss of 5-hydroxymethylcytosine is accompanied with malignant cellular transformation.
21778364 2011 Tet proteins can convert 5-methylcytosine to 5-formylcytosine and 5-carboxylcytosine.
21496894 2011 Hydroxylation of 5-methylcytosine by TET1 promotes active DNA demethylation in the adult brain.
21490601 2011 TET1 and hydroxymethylcytosine in transcription and DNA methylation fidelity.
21311766 2011 Different binding properties and function of CXXC zinc finger domains in Dnmt1 and Tet1.
21251613 2011 Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of ?-ketoglutarate-dependent dioxygenases.
19923888 2009 TET proteins in malignant hematopoiesis.
19420352 2009 Genetic characterization of TET1, TET2, and TET3 alterations in myeloid malignancies.
19372393 2009 The nuclear DNA base 5-hydroxymethylcytosine is present in Purkinje neurons and the brain.
19372391 2009 Conversion of 5-methylcytosine to 5-hydroxymethylcytosine in mammalian DNA by MLL partner TET1.
19144982 2009 The MLL recombinome of adult CD10-negative B-cell precursor acute lymphoblastic leukemia: results from the GMALL study group.
18163421 2008 Association analysis of 528 intra-genic SNPs in a region of chromosome 10 linked to late onset Alzheimer's disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12646957 2003 TET1, a member of a novel protein family, is fused to MLL in acute myeloid leukemia containing the t(10;11)(q22;q23).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124344 2002 LCX, leukemia-associated protein with a CXXC domain, is fused to MLL in acute myeloid leukemia with trilineage dysplasia having t(10;11)(q22;q23).
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.