Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.43
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 2.6e-02
astrocytic glioma -2.400 2.1e-03
Astrocytoma, Pilocytic -1.800 1.4e-04
atypical teratoid / rhabdoid tumor -1.500 2.0e-06
ependymoma -1.200 2.5e-02
glioblastoma -1.600 1.1e-06
group 3 medulloblastoma -2.200 1.1e-02
medulloblastoma, large-cell -1.400 4.3e-03
oligodendroglioma -2.300 1.7e-02
osteosarcoma -2.088 3.9e-08
Pick disease -1.600 3.0e-02
primitive neuroectodermal tumor -1.900 6.0e-05

Gene RIF (6)

AA Sequence

MEASVLSPTSWEKRRAWLRQSRNWQTQVLEEEAAAALQDVPDPEPSSLDDVFQEGNPINKIEDWLQDCGY      1 - 70
SEEGFSEEAGQFIYNGFCSHGTSFEDDLTLGAEATLLAANGKLFSRSFLETARPCQLLDLGCSLASSSMT     71 - 140
GGTNKTSSSISEILDKVQEDAEDVLFSLGFGQEDHKDTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEM    141 - 210
EDPCLMLASRFKQVQTLAVTADAFFCLYSYVSKTPVQKFTPSHMFWNCNHPTDVPSIRILSREPEPQSPR    211 - 280
DRLRKAISKMCLYTCPRDRPPPPHNTPKRNSLDQVVLEVMDKVKEEKQFLQQDSDLGQFSQEDPVPPAEG    281 - 350
KKLPTSPYPCVFCCEEETQQRMSTVLAPSQTLDSNPKVPCCTHSLPIEDPQWSTDPAQIRRELCSLPATN    351 - 420
TETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEV    421 - 490
QSNSEEEQSQSRWPSRPRHPHHHQTFAGKDS                                           491 - 521
//

Text Mined References (14)

PMID Year Title