Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.26
PubTator Score 6.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 3.9e-08
osteosarcoma 7933 5.4e-06
breast carcinoma 1614 1.3e-04
fibroadenoma 557 1.7e-03
invasive ductal carcinoma 2950 4.6e-03
Disease Target Count Z-score Confidence
Esophageal cancer 30 3.29 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.887 5.4e-06
breast carcinoma 1.800 1.3e-04
fibroadenoma 1.500 1.7e-03
invasive ductal carcinoma 1.800 4.6e-03
ovarian cancer 1.200 3.9e-08

Gene RIF (1)

PMID Text
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPA      1 - 70
LGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPL     71 - 140
GAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPM    141 - 210
VICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGA    211 - 280
LPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAF    281 - 350
QPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQ    351 - 420
TGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGR    421 - 490
CLSQILHTEFKSKGLKME                                                        491 - 508
//

Text Mined References (9)

PMID Year Title
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14648882 2004 Tesmin transcription is regulated differently during male and female meiosis.
12606435 2003 Native tesmin is a 60-kilodalton protein that undergoes dynamic changes in its localization during spermatogenesis in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11803038 2002 Germ cell-specific nucleocytoplasmic shuttling protein, tesmin, responsive to heavy metal stress in mouse testes.
10191092 1999 A novel testis-specific metallothionein-like protein, tesmin, is an early marker of male germ cell differentiation.