Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.47
PubTator Score 1.57

Knowledge Summary

Patent (1,117)

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 2.3e-03
pituitary cancer 1.300 5.4e-03
primitive neuroectodermal tumor -1.100 4.0e-05
psoriasis 1.100 1.0e-03
subependymal giant cell astrocytoma -1.021 3.4e-02
ulcerative colitis -1.100 1.8e-03

AA Sequence

MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFTCEKIGSGFFS      1 - 70
EVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQ     71 - 140
LLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENGYSAVVADFGLAEKIPDVSMG    141 - 210
SEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDC    211 - 280
PPDFLQLTFNCCNMDPKLRPSFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDK    281 - 350
IPHKSPCPRRTIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPS    351 - 420
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLK    421 - 490
YRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSG    491 - 560
IGLQTQGKQDG                                                               561 - 571
//

Text Mined References (12)

PMID Year Title