Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.27
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.400 3.9e-02
esophageal adenocarcinoma 1.900 2.0e-02
osteosarcoma -3.869 1.5e-04
chronic lymphosyte leukemia 1.100 2.3e-05
group 4 medulloblastoma -1.600 9.4e-04
glioblastoma -1.100 3.7e-02
medulloblastoma, large-cell -1.900 1.0e-04
primitive neuroectodermal tumor -1.200 1.4e-02
adrenocortical carcinoma -1.776 8.7e-05
intraductal papillary-mucinous adenoma (... 1.100 3.3e-03
lung cancer 1.200 6.6e-04
active Crohn's disease 1.457 3.8e-03
active ulcerative colitis 2.046 7.9e-03
breast carcinoma -1.700 2.8e-05
interstitial cystitis -2.300 6.8e-05
lung adenocarcinoma 1.300 2.2e-05
non-inflammatory breast cancer -4.700 1.8e-09
lung carcinoma 1.600 1.2e-28
invasive ductal carcinoma -1.100 6.6e-04
pituitary cancer 1.100 2.2e-02
psoriasis -1.200 8.6e-31

Gene RIF (7)

PMID Text
25935310 CHP3 functions as a novel negative regulator of cardiomyocyte hypertrophy via inhibition of GSK3alpha/beta phosphorylation.
24811141 TESC is overexpressed in colorectal cancer
24776739 This study demonstrated that highly significant effects of rs7294919 of tescalcin on hippocampal gray matter volumes.
24659803 a binding partner and regulator of subunit 4 of the COP9 signalosome
22984264 Loss of both N-myristoylation and calcium binding of CHP3 decreases cell surface stability of NHE1.
20060826 Tescalcin is one of the key gene products that is involved in switching differentiation program in some cell types.
18321853 CHP3 binds directly to the proximal juxtamembrane C-terminal region (amino acids 505-571) of rat NHE1 in the same region that binds CHP1 and CHP2.

AA Sequence

MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNR      1 - 70
NLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVE     71 - 140
ELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETM    141 - 210
ALCH                                                                      211 - 214
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25935310 2015 Calcineurin B homologous protein 3 negatively regulates cardiomyocyte hypertrophy via inhibition of glycogen synthase kinase 3 phosphorylation.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24811141 2014 The EF-hand calcium-binding protein tescalcin is a potential oncotarget in colorectal cancer.
24776739 2015 Multimodal imaging of a tescalcin (TESC)-regulating polymorphism (rs7294919)-specific effects on hippocampal gray matter structure.
24659803 2014 Regulation of Cop9 signalosome activity by the EF-hand Ca2+-binding protein tescalcin.
22984264 2012 N-myristoylation and Ca2+ binding of calcineurin B homologous protein CHP3 are required to enhance Na+/H+ exchanger NHE1 half-life and activity at the plasma membrane.
21553168 2011 Controlled release systems containing solid dispersions: strategies and mechanisms.
21269460 2011 Initial characterization of the human central proteome.
20060826 2010 Up- or downregulation of tescalcin in HL-60 cells is associated with their differentiation to either granulocytic or macrophage-like lineage.
19345287 2009 Expression and evolutionary conservation of the tescalcin gene during development.
18321853 2008 Calcineurin B homologous protein 3 promotes the biosynthetic maturation, cell surface stability, and optimal transport of the Na+/H+ exchanger NHE1 isoform.
17717601 2007 Tescalcin is an essential factor in megakaryocytic differentiation associated with Ets family gene expression.
16541075 2006 The finished DNA sequence of human chromosome 12.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661968 2003 Characterization of tescalcin, a novel EF-hand protein with a single Ca2+-binding site: metal-binding properties, localization in tissues and cells, and effect on calcineurin.
12809501 2003 The Na+/H+ exchanger cytoplasmic tail: structure, function, and interactions with tescalcin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11696366 2001 Human homolog of mouse tescalcin associates with Na(+)/H(+) exchanger type-1.
11145610 2001 Tescalcin, a novel gene encoding a putative EF-hand Ca(2+)-binding protein, Col9a3, and renin are expressed in the mouse testis during the early stages of gonadal differentiation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.