Property Summary

NCBI Gene PubMed Count 146
PubMed Score 394.20
PubTator Score 338.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
Crohn's disease -1.138 1.4e-02
ulcerative colitis -1.360 2.0e-02
ovarian cancer -1.300 2.6e-05

Gene RIF (87)

PMID Text
26658719 Data indicate that overexpression of telomeric repeat binding factor 1 (TRF1) in aging endothelial cells (EC) reduced telomere-associated DNA damage foci.
26403970 ZSCAN4 indirectly interacts with TRF1 in cancer cells. We show that ZSCAN4 plays an important role independent of telomere maintenance pathways (telomerase positive and alternative pathway) or cell lineage.
26240333 analysis of human telomere repeat binding factor 1 (hTRF1) in complex with Escherichia coli Hsp70 (DnaK)
25892537 Results showed significant interaction between variants at TERF1 and AFAP1L2 loci. Given the key role of TERF1 in telomere biology and its physical interaction with AFAP1L2, these results support a role for telomere dysfunction in melanoma development.
25819337 we provide mechanistic insight into the role of TRF1 in liver regeneration and provide a mouse model recapitulating the clinical features of LLCC.
24876105 Modulating miR-155 expression in cells altered TRF1 levels and TRF1 abundance at telomeres. Compromising TRF1 expression by elevating miR-155 increased telomere fragility and altered the structure of metaphase chromosomes.
24752893 this study demonstrates an essential role of TRF1 in the centromeric localization of Aurora-B kinase, which is required for correction of the merotelic attachment of microtubules to a single kinetochore and for proper chromosome segregation.
24692559 TAP68 functions in mediating TRF1-tankyrase 1 localization to the centrosome and in mitotic regulation
24626180 TRF1 links TopoIIalpha and SAC proteins in a pathway that ensures correct telomere replication and mitotic segregation, unveiling how TRF1 protects from telomere fragility and mitotic defects.
24415760 these findings suggested that PinX1 may maintain telomere integrity by regulating TRF1 stability and that hTERT may act as both a positive and a negative regulator of TRF1 homeostasis in a PinX1-dependent manner.
24389012 U2AF65 represents a new route for modulating TRF1 function at telomeres.
24091727 TRF1 knockdown suppressed Nek2- induced lagging chromosomes, suggesting that TRF1 may affect kinetochore capture by mitotic spindles.
23959892 Data show that RTEL1 interacts with the shelterin protein TRF1, indicating a potential recruitment mechanism of RTEL1 to telomeres.
23702294 This improved model also reveals extensive indirect readout, which suggests that telomere recognition by TRF1 will be affected by changes to DNA helical parameters such as bending.
23583392 Results indicate that beta-TrCP1 is involved in the negative regulation of TRF1.
23268632 TRF1 is an important factor in the colorectal tumor progression and maybe a diagnostic factor
22878603 Low TRF1 expression is associated with chronic lymphocytic leukemia.
22790221 TRF1 binds to and stabilizes common fragile site on Chromosome 2q14.
22641345 The nucleostemin(NS)could promote the recruitment of PML-IV to SUMOylated TRF1 in TA(+) and ALT cells.
22336916 The TRF1 stimulates the binding and enzymatic activities of the LP-BER proteins APE1, FEN1 and LigI both individually and when they act together in reconstituted LP-BER using a telomeric substrate.
22331467 one function of PinX1 is to stabilize TRF1 during mitosis, perhaps to promote transition into M phase of the cell cycle.
22225189 It is found that water molecules around the DNA are more structured with significantly higher density and ordering than that around the protein in the complex.
22045740 NS inhibits TRF1 dimerization and shortens TRF1 association with the telomere.
21423270 A subset of TRF1 and TRF2 binding sites correspond to nontelomeric satellite DNA repeats.
21209389 Mouse gene deletion experiments revealed DNA-damage-response pathways that threaten chromosome ends and how the components of the telomeric shelterin complex prevent activation of these pathways.[Shelterin]
21119197 the telomerase inhibitor PinX1 is recruited to telomeres by TRF1 and provides a critical link between TRF1 and telomerase inhibition to prevent telomere elongation and help maintain telomere homeostasis.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20937264 Observational study of gene-disease association. (HuGE Navigator)
20811636 the protein network surrounding telomere repeat binding factors, TRF1, TRF2, and POT1 using dual-tag affinity purification
20644899 Monoclonal gammopathy of undetermined significance patients showed increased TRF1 levels and lower expression of TRF2 and TANK1 compared with multiple myeloma patients.
20549820 Observational study of gene-disease association. (HuGE Navigator)
20160025 TRF1 phosphorylation by excessive Aurora-A may provoke abnormal mitosis and chromosomal instability.
20159592 results reveal an atypical small GTPase domain within Fbx4 as a substrate-binding motif for SCF(Fbx4) and uncover a mechanism for selective ubiquitination and degradation of TRF1 in telomere homeostasis control
20137830 Age-dependent telomere shortening occurs in Duchenne muscular dystrophy muscles and is associated with overexpression of mRNA and protein levels of TRF1 and poly (ADP-ribose) polymerase (PARP)1.
20127252 The expression of TRF1 may work to reduce the telomere length in precancerous lesions and offer new insight into the mechanism of carcinogenesis in gastric cancer.
20056655 Atomic Force Microscopy imaging shows that hTRF1 induces compaction of telomeric DNA only in the presence of a nucleosome, suggesting that this compaction occurs through hTRF1-nucleosome interactions.
20056641 Observational study of gene-disease association. (HuGE Navigator)
19887064 Kinetic analysis of DNA-dependent intrinsic tryptophan fluorescence quenching of hTRF1 revealed a two step binding process that is impacted by telomere repeat length, position, and structure
19817957 Observational study of gene-disease association. (HuGE Navigator)
19773453 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19766477 Observational study of gene-disease association. (HuGE Navigator)
19746267 nuclear localization signal and nuclear export signal sequences in NSCLCs patients did not have mutations.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19596237 Gene deletion experiments showed that efficient duplication of telomeres requires the shelterin component TRF1.
19265708 Results show that hPinX1 regulates the nucleolar accumulation and telomeric association of TRF1.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19164295 RLIM represents a new pathway for telomere maintenance by modulating the level of TRF1 at telomeres.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18625707 Plk1 interacts with and phosphorylates TRF1 and Plk1-mediated phosphorylation is involved in both TRF1 overexpression-induced apoptosis and its telomeric DNA binding ability
18397896 down-regulation of telomeric repeat binding factor 1 expression appeared in lung cancer tissue.
18347021 CK2-mediated phosphorylation of TRF1 plays an important role in modulating telomere length homeostasis by determining the levels of TRF1 at telomeres
18221737 even without TRF1 PARsylation, this mutant tankyrase 1 seemed to loosen the closed structure of the telomeric heterochromatin
18202258 results indicate that binding to the TRFH docking site involves the sequence F/Y-X-L-X-P in shelterin-associated proteins, which contacts the same molecular recognition surface of the TRFH domains of TRF1 & TRF2 with distinct specificities
18178559 TRF1 and TRF2 bind to the dsDNA of telomeres, whereas POT1 binds to the ssDNA portion
17848914 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17765874 These results suggest that c-Myc may be involved in the regulation of telomere length through its direct binding with TRF1/PIN2.
17694070 TRF1 association with telomeres induced by ATM inhibition is abrogated in cells lacking MRE11 or NBS1, suggesting that MRN and ATM function in the same pathway controlling TRF1 binding to telomeres
17681636 our hypothesis is that when the TRF length becomes shorter during tumour progression, the tumour cells can sustain a better tolerance to shorter telomere with the help of both TRF1 and TRF2, but without immediate activation of the telomerase
17561506 tankyrase1 is a poly(ADP-ribose) polymerase with roles in telomere length control by the TRF1 component of the shelterin complex
17020976 significantly lower expression of TRF1 was associated with non-small cell lung cancer
16880378 coordinated interactions among TPP1, TIN2, TRF1, and TRF2 may ensure robust assembly of the telosome, telomere targeting of its subunits, and, ultimately, regulated telomere maintenance
16786598 An increase in TIN2 expression in adult T-cell leukemia which may be a markerse for disease progression.
16756990 TRF1 is able to specifically recognize telomeric binding sites located within nucleosomes, forming a ternary complex.
16647572 Observational study of gene-disease association. (HuGE Navigator)
16421973 TRF1 protein levels are related to the activity of telomerase and may have a role in human acute leukemia
16358369 CONCLUSION: hTRF1 mutation is probably not one of the main factors for telomerase activation in malignant hematopoietic disease.
16275645 Fbx4 is a central regulator of Pin2/TRF1 protein abundance and alterations in the stability of Pin2/TRF1 can have a dramatic impact on telomere length
15792519 Loss of TRF1 expression capability, as a result of down-regulation of TRF1 expression in malignant gliomas cells, may play a role in the malignant progression of astroglial brain tumors.
15632001 May be involved in multistep hepatocarcinogenesis by playing crucial role in telomere shortening.
15608617 X-ray crystal structures of both TRF1- and TRF2-DNA binding domains in complex with telomeric DNA (2.0 and 1.8 angstroms resolution, respectively) show that they recognize the same TAGGGTT binding site by means of homeodomains
15389875 Results report the detection of new alternative transcripts of the TRF1/Pin2 gene in peripheral blood lymphocytes resulting from a 76 nucleotide insertion.
15316005 TIN2 binds TRF1 and TRF2 simultaneously and stabilizes the TRF2 complex on telomeres
15133513 Partial knockdown of TIN2 by small hairpin RNA in a telomerase-positive cell line resulted in telomere elongation, which is typical of reduced TRF1 function.
15100233 hRap1 negatively regulates telomere length in vivo and the linker region of hRap1 may modulate the recruitment of negative regulators of telomere length
14966275 Results provide evidence that specific ankyrin repeat cluster-TRF1 interactions play roles in the essential catalytic function of tankyrase 1.
12915656 the level of telomeric repeat binding factor 1 expression may be helpful prognostically for patients with adrenal cortical cancers
12768206 the interaction between the TRF1 complex and POT1 affects the loading of POT1 on the single-stranded telomeric DNA, thus transmitting information about telomere length to the telomere terminus, where telomerase is regulated
12530079 Down-regulation of TRF1, TRF2 and TIN2 genes is important to maintain telomeric DNA for gastric cancers.
12080061 Identification of a tankyrase-binding motif in this protein
12007281 Gastric carcinomas with high TRF1 expression may require a large quantity of hRap1/
11971978 Results showed that targeting of TRF1 and TRF2 to specific telomeres could be induced, and that targeting leads to telomere shortening. This indicates that these proteins act in cis to repress telomere elongation.
11854288 The telomeric poly(ADP-ribose) polymerase, tankyrase 1, contains multiple binding sites for telomeric repeat binding factor 1 (TRF1) and a novel acceptor, 182-kDa tankyrase-binding protein (TAB182).
11813863 tumour growth does not seem to depend on cell proliferation but on TRF1 immunoexpression
11751684 Isoform PIN2 interacts with the human SALL1 gene product.
11744712 inhibition of Pin2/TRF1 in A-T cells is able to bypass the requirement for ATM in specifically restoring telomere shortening, the G(2)/M checkpoint defect, and radiosensitivity
11313893 Pin2/TRF1 (TERF1) can specifically induce entry into mitosis and apoptosis, likely via a mechanism related to activation of caspase-3.

AA Sequence

MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEA      1 - 70
EAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDA     71 - 140
QFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF    141 - 210
KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSG    211 - 280
NDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKK    281 - 350
KKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML    351 - 420
KDRWRTMKKLKLISSDSED                                                       421 - 439
//

Text Mined References (152)

PMID Year Title
26658719 2016 Age intrinsic loss of telomere protection via TRF1 reduction in endothelial cells.
26586433 2015 ATM and ATR Signaling Regulate the Recruitment of Human Telomerase to Telomeres.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26403970 2015 ZSCAN4 and TRF1: A functionally indirect interaction in cancer cells independent of telomerase activity.
26240333 2015 Mapping the conformation of a client protein through the Hsp70 functional cycle.
25892537 2015 Integrated pathway and epistasis analysis reveals interactive effect of genetic variants at TERF1 and AFAP1L2 loci on melanoma risk.
25819337 2015 Chronic replicative stress induced by CCl4 in TRF1 knockout mice recapitulates the origin of large liver cell changes.
25620558 2015 TRF2 recruits RTEL1 to telomeres in S phase to promote t-loop unwinding.
25589350 2015 Single-strand DNA-binding protein SSB1 facilitates TERT recruitment to telomeres and maintains telomere G-overhangs.
25416956 2014 A proteome-scale map of the human interactome network.
24876105 2014 miR-155 drives telomere fragility in human breast cancer by targeting TRF1.
24752893 2014 TRF1 ensures the centromeric function of Aurora-B and proper chromosome segregation.
24692559 2014 The 68-kDa telomeric repeat binding factor 1 (TRF1)-associated protein (TAP68) interacts with and recruits TRF1 to the spindle pole during mitosis.
24626180 2014 TopoII? prevents telomere fragility and formation of ultra thin DNA bridges during mitosis through TRF1-dependent binding to telomeres.
24415760 2014 PinX1, a telomere repeat-binding factor 1 (TRF1)-interacting protein, maintains telomere integrity by modulating TRF1 homeostasis, the process in which human telomerase reverse Transcriptase (hTERT) plays dual roles.
24389012 2014 The splicing factor U2AF65 stabilizes TRF1 protein by inhibiting its ubiquitin-dependent proteolysis.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24095731 2013 TRF2 interaction with Ku heterotetramerization interface gives insight into c-NHEJ prevention at human telomeres.
24091727 2013 Mitotic perturbations induced by Nek2 overexpression require interaction with TRF1 in breast cancer cells.
23959892 2013 Inherited mutations in the helicase RTEL1 cause telomere dysfunction and Hoyeraal-Hreidarsson syndrome.
23702294 2013 A comprehensive model for the recognition of human telomeres by TRF1.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
23583392 2013 The F-box protein ?-TrCP promotes ubiquitination of TRF1 and regulates the ALT-associated PML bodies formation in U2OS cells.
23268632 Telomeric repeat factor 1 protein levels correlates with telomere length in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22878603 2013 Telomeres and chromosomal instability in chronic lymphocytic leukemia.
22790221 2012 A TRF1-controlled common fragile site containing interstitial telomeric sequences.
22641345 2012 Nucleostemin prevents telomere damage by promoting PML-IV recruitment to SUMOylated TRF1.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22336916 2012 Telomere proteins POT1, TRF1 and TRF2 augment long-patch base excision repair in vitro.
22331467 2012 PinX1 localizes to telomeres and stabilizes TRF1 at mitosis.
22225189 2011 Conformational fluctuations of a protein-DNA complex and the structure and ordering of water around it.
22153077 2011 Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease.
22045740 2011 Nucleostemin inhibits TRF1 dimerization and shortens its dynamic association with the telomere.
21852327 2011 Characterization of the DNA binding specificity of Shelterin complexes.
21423270 2011 The human TTAGGG repeat factors 1 and 2 bind to a subset of interstitial telomeric sequences and satellite repeats.
21209389 2010 How shelterin solves the telomere end-protection problem.
21119197 2011 Telomerase inhibitor PinX1 provides a link between TRF1 and telomerase to prevent telomere elongation.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20937264 2011 Genetic variants in eleven telomere-associated genes and the risk of incident cardio/cerebrovascular disease: The Women's Genome Health Study.
20811636 2010 The protein network surrounding the human telomere repeat binding factors TRF1, TRF2, and POT1.
20696165 2010 Tankyrase-1 assembly to large protein complexes blocks its telomeric function.
20644899 Altered mRNA expression of telomere-associated genes in monoclonal gammopathy of undetermined significance and multiple myeloma.
20549820 2010 Telomere length and genetic analyses in population-based studies of endometrial cancer risk.
20181953 2010 Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
20160025 2010 TRF1 mediates mitotic abnormalities induced by Aurora-A overexpression.
20159592 2010 Structural basis of selective ubiquitination of TRF1 by SCFFbx4.
20137830 2011 Telomere shortening is associated to TRF1 and PARP1 overexpression in Duchenne muscular dystrophy.
20127252 2010 Expression of TRF1, TRF2, TIN2, TERT, KU70, and BRCA1 proteins is associated with telomere shortening and may contribute to multistage carcinogenesis of gastric cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056655 2010 The human telomeric protein hTRF1 induces telomere-specific nucleosome mobility.
20056641 2010 Multiple genetic variants in telomere pathway genes and breast cancer risk.
19887064 2010 Intrinsic hTRF1 fluorescence quenching reveals details of telomere DNA binding activity: impact of DNA length, structure and position of telomeric repeats.
19854130 2009 RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19773453 2009 Polymorphisms in telomere maintenance genes and risk of lung cancer.
19766477 2009 Polymorphisms in telomere-associated genes, breast cancer susceptibility and prognosis.
19746267 2009 Analysis of the nuclear localization signal of TRF1 in non-small cell lung cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19596237 2009 Mammalian telomeres resemble fragile sites and require TRF1 for efficient replication.
19487455 2009 GNL3L stabilizes the TRF1 complex and promotes mitotic transition.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19265708 2009 Human PinX1 mediates TRF1 accumulation in nucleolus and enhances TRF1 binding to telomeres.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19164295 2009 Ubiquitin Ligase RLIM Modulates Telomere Length Homeostasis through a Proteolysis of TRF1.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625707 2008 Plk1 phosphorylation of TRF1 is essential for its binding to telomeres.
18397896 2008 Expression of telomeric repeat binding factor 1 protein in nonsmall cell lung cancer with human telomerase reverse transcriptase positive.
18347021 2008 Regulation of telomeric repeat binding factor 1 binding to telomeres by casein kinase 2-mediated phosphorylation.
18221737 2008 Telomere elongation by a mutant tankyrase 1 without TRF1 poly(ADP-ribosyl)ation.
18202258 2008 A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
18178559 2008 Tethering telomeric double- and single-stranded DNA-binding proteins inhibits telomere elongation.
17962804 2007 Protein requirements for sister telomere association in human cells.
17848914 2007 Genetic variation in five genes important in telomere biology and risk for breast cancer.
17765874 2007 c-Myc interacts with TRF1/PIN2 and regulates telomere length.
17694070 2007 MRE11-RAD50-NBS1 and ATM function as co-mediators of TRF1 in telomere length control.
17681636 2007 Modulation of telomere shelterin by TRF1 [corrected] and TRF2 interacts with telomerase to maintain the telomere length in non-small cell lung cancer.
17629495 2007 Expression, purification, and characterization of Tara, a novel telomere repeat-binding factor 1 (TRF1)-binding protein.
17561506 2007 The role of the poly(ADP-ribose) polymerase tankyrase1 in telomere length control by the TRF1 component of the shelterin complex.
17389648 2007 Conserved interactions of the splicing factor Ntr1/Spp382 with proteins involved in DNA double-strand break repair and telomere metabolism.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17020976 2006 Expression of telomere-associated genes as prognostic markers for overall survival in patients with non-small cell lung cancer.
16880378 2006 A critical role for TPP1 and TIN2 interaction in high-order telomeric complex assembly.
16786598 2006 Increased expression of telomere length regulating factors TRF1, TRF2 and TIN2 in patients with adult T-cell leukemia.
16756990 2006 The human telomeric protein TRF1 specifically recognizes nucleosomal binding sites and alters nucleosome structure.
16647572 2006 Genetic variation in telomeric repeat binding factors 1 and 2 in aplastic anemia.
16421973 2006 A study of the relationship between expression level of TRF1 protein and telomerase activity in human acute leukemia.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16358369 2005 Study on the expression and mutation of human telomeric repeat binding factor (hTRF1) in 10 malignant hematopoietic cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275645 2006 The F-box protein FBX4 targets PIN2/TRF1 for ubiquitin-mediated degradation and regulates telomere maintenance.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16166375 2005 Shelterin: the protein complex that shapes and safeguards human telomeres.
15792519 2005 Expression of telomeric repeat binding factor-1 in astroglial brain tumors.
15632001 2005 Up-regulation of telomere-binding proteins, TRF1, TRF2, and TIN2 is related to telomere shortening during human multistep hepatocarcinogenesis.
15608617 2005 How the human telomeric proteins TRF1 and TRF2 recognize telomeric DNA: a view from high-resolution crystal structures.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389875 2004 Identification of alternative transcripts of the TRF1/Pin2 gene.
15383534 2004 Telosome, a mammalian telomere-associated complex formed by multiple telomeric proteins.
15380063 2004 A dynamic molecular link between the telomere length regulator TRF1 and the chromosome end protector TRF2.
15316005 2004 TIN2 binds TRF1 and TRF2 simultaneously and stabilizes the TRF2 complex on telomeres.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231715 2004 POT1-interacting protein PIP1: a telomere length regulator that recruits POT1 to the TIN2/TRF1 complex.
15229185 2004 Association and regulation of the BLM helicase by the telomere proteins TRF1 and TRF2.
15181449 2004 PTOP interacts with POT1 and regulates its localization to telomeres.
15133513 2004 TIN2 is a tankyrase 1 PARP modulator in the TRF1 telomere length control complex.
15100233 2004 The human Rap1 protein complex and modulation of telomere length.
15007108 2004 Telomere-bound TRF1 and TRF2 stall the replication fork at telomeric repeats.
14966275 2004 Functional subdomain in the ankyrin domain of tankyrase 1 required for poly(ADP-ribosyl)ation of TRF1 and telomere elongation.
14715659 2004 DNA binding features of human POT1: a nonamer 5'-TAGGGTTAG-3' minimal binding site, sequence specificity, and internal binding to multimeric sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12915656 2003 Diagnostic and prognostic value of fas and telomeric-repeat binding factor-1 genes in adrenal tumors.
12782650 2003 TRF1 is degraded by ubiquitin-mediated proteolysis after release from telomeres.
12768206 2003 POT1 as a terminal transducer of TRF1 telomere length control.
12667345 2002 [Preparation and characterization of monoclonal antibody against human telomeric repeat binding factor 1].
12530079 Down-regulation of TRF1, TRF2 and TIN2 genes is important to maintain telomeric DNA for gastric cancers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135354 2002 Nuclear import pathway of the telomere elongation suppressor TRF1: inhibition by importin alpha.
12080061 2002 Identification of a tankyrase-binding motif shared by IRAP, TAB182, and human TRF1 but not mouse TRF1. NuMA contains this RXXPDG motif and is a novel tankyrase partner.
12007281 2001 Expression of MRE11 complex (MRE11, RAD50, NBS1) and hRap1 and its relation with telomere regulation, telomerase activity in human gastric carcinomas.
11971978 2002 Targeting assay to study the cis functions of human telomeric proteins: evidence for inhibition of telomerase by TRF1 and for activation of telomere degradation by TRF2.
11943150 2002 Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle.
11854288 2002 The telomeric poly(ADP-ribose) polymerase, tankyrase 1, contains multiple binding sites for telomeric repeat binding factor 1 (TRF1) and a novel acceptor, 182-kDa tankyrase-binding protein (TAB182).
11802774 2002 Tankyrase-2 oligomerizes with tankyrase-1 and binds to both TRF1 (telomere-repeat-binding factor 1) and IRAP (insulin-responsive aminopeptidase).
11751684 2001 SALL1, the gene mutated in Townes-Brocks syndrome, encodes a transcriptional repressor which interacts with TRF1/PIN2 and localizes to pericentromeric heterochromatin.
11739745 2002 Role for the related poly(ADP-Ribose) polymerases tankyrase 1 and 2 at human telomeres.
11738049 2001 Solution structure of a telomeric DNA complex of human TRF1.
11701125 2001 The Pin2/TRF1-interacting protein PinX1 is a potent telomerase inhibitor.
11545737 2001 Structure of the TRFH dimerization domain of the human telomeric proteins TRF1 and TRF2.
11375976 2001 Telomeric protein Pin2/TRF1 as an important ATM target in response to double strand DNA breaks.
11327863 2001 TRF1 inhibits telomere C-strand DNA synthesis in vitro.
11313893 2001 Telomeric protein Pin2/TRF1 induces mitotic entry and apoptosis in cells with short telomeres and is down-regulated in human breast tumors.
10988299 2000 Tankyrase is a golgi-associated mitogen-activated protein kinase substrate that interacts with IRAP in GLUT4 vesicles.
10913111 2000 NBS1 and TRF1 colocalize at promyelocytic leukemia bodies during late S/G2 phases in immortalized telomerase-negative cells. Implication of NBS1 in alternative lengthening of telomeres.
10669743 2000 Control of human telomere length by TRF1 and TRF2.
10581025 1999 TIN2, a new regulator of telomere length in human cells.
9822378 1998 Tankyrase, a poly(ADP-ribose) polymerase at human telomeres.
9739097 1998 Solution structure of the DNA-binding domain of human telomeric protein, hTRF1.
9480811 1998 Association of nucleoside diphosphate kinase nm23-H2 with human telomeres.
9391075 1997 Characterization and cell cycle regulation of the related human telomeric proteins Pin2 and TRF1 suggest a role in mitosis.
9326950 1997 Human telomeres contain two distinct Myb-related proteins, TRF1 and TRF2.
9130722 1997 TRF1 is a dimer and bends telomeric DNA.
9034193 1997 Control of telomere length by the human telomeric protein TRF1.
9002672 1997 Comparison of the human and mouse genes encoding the telomeric protein, TRF1: chromosomal localization, expression and conserved protein domains.
8614633 1996 The telobox, a Myb-related telomeric DNA binding motif found in proteins from yeast, plants and human.
8606777 1996 A human peptidyl-prolyl isomerase essential for regulation of mitosis.
7502076 1995 A human telomeric protein.
1406665 1992 A mammalian factor that binds telomeric TTAGGG repeats in vitro.