Property Summary

NCBI Gene PubMed Count 157
PubMed Score 417.45
PubTator Score 338.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
Crohn's disease -1.138 1.4e-02
ovarian cancer -1.300 2.6e-05
ulcerative colitis -1.360 2.0e-02

Protein-protein Interaction (5)

PDB (10)

Gene RIF (93)

AA Sequence

MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEA      1 - 70
EAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDA     71 - 140
QFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF    141 - 210
KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSG    211 - 280
NDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKK    281 - 350
KKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML    351 - 420
KDRWRTMKKLKLISSDSED                                                       421 - 439
//

Text Mined References (164)

PMID Year Title