Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.7e-10
medulloblastoma, large-cell 6234 1.5e-04
Disease Target Count Z-score Confidence
Infertility 163 3.349 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.5e-04
ovarian cancer 1.200 1.7e-10

 GO Function (1)

AA Sequence

MESEDTKKTQEMKTDLNLLLECLKYQMDNAFSQKEALVTIHSICQQNSNASVYFREIGGLMFVKNLAKSS      1 - 70
EHSMVKEAALYTLGAIAEKNVYCQQTLCTSELFEDLTWFLSNDSNINLKRMSVYVILVLVSNNRTGQTLV     71 - 140
RETGCITVLSRLFRTVISKHELDLSDKNVFQSYQLWSSVCSTLCVCVNNPQNDENQMFCCSLFPHANEWL    141 - 210
KNCTTPEIIRPICSFIGLTLANNTYVQKYFVSVGGLDVLSQVLMQLESDSHETLSSAKLAVVVTKTVDAC    211 - 280
IADNPTFGIVLSKYHIVSKLLALLLHESLDSGEKFSIMLTLGHCTEDCEENQYDLFKNNGLPLMIQALTE    281 - 350
SQNEELNKAATFVLHNCKKITEKLSLSLGEYPFDENETQQLKDISVKENNLEEHWRKAKEILHRIEQLER    351 - 420
EGNEEEIQRENYQDNISSMNISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQ    421 - 490
MKTPLKSANPVHACYRESEQNKTLYKAKSSCNQNLHEETTFEKNFVSQSSDHVFKHPVHIAKNIKQQLPV    491 - 560
TDPFTLCSDIINKEVVSFLATPSCSEMLTYRCSGCIAVEKSLNSRNFSKLLHSCPYQCDRHKVIVEAEDR    561 - 630
YKSELRKSLICNKKILLTPRRRQRLSNESTTPGGIKKRRIRKNFTEEEVNYLFNGVKKMGNHWNSILWSF    631 - 700
PFQQGRKAVDLAHKYHKLTKHPTCAAS                                               701 - 727
//

Text Mined References (5)

PMID Year Title
24413433 2014 The TRF1-binding protein TERB1 promotes chromosome movement and telomere rigidity in meiosis.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.