Property Summary

NCBI Gene PubMed Count 201
PubMed Score 855.58
PubTator Score 636.09

Knowledge Summary

Patent (148,559)

TINX Plot

  Disease (8)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.500 2.0e-02
ependymoma -1.500 2.7e-02
oligodendroglioma -1.500 1.1e-02
psoriasis 1.500 3.7e-04
glioblastoma multiforme -1.200 1.8e-16
osteosarcoma -2.051 6.1e-03
cystic fibrosis 2.367 1.1e-04
medulloblastoma, large-cell -2.100 3.0e-03
adrenocortical carcinoma -2.467 7.0e-07
non-small cell lung cancer -3.024 6.8e-32
intraductal papillary-mucinous carcinoma... -2.000 1.3e-03
intraductal papillary-mucinous neoplasm ... -2.100 6.2e-03
lung cancer -4.700 5.6e-07
interstitial cystitis 2.000 1.3e-04
lung adenocarcinoma -3.600 2.2e-24
lung carcinoma -2.700 3.0e-13
invasive ductal carcinoma -2.000 7.6e-04
ulcerative colitis 1.400 4.9e-05
ovarian cancer 1.600 5.4e-11

 CSPA Cell Line (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (163)

PMID Text
26858516 dysregulation of the angiopoietin (Angpt)/Tie2 ligand receptor system may be crucial for endothelial dysfunction in hemolytic uremic syndrome
26659448 These results suggest that Tie2 signaling induces alpha4beta1 integrin activation on bone marrow-mast cell progenitor for adhesion to VCAM-1.
26642851 In the absence of Tie-2, VE-PTP inhibition destabilizes endothelial barrier integrity in agreement with the VE-cadherin-supportive effect of VE-PTP.
26489611 The inhibition of Tie-2 exerted by Tie-1can be relieved by Tie-1 ectodomain cleavage mediated by tumor- and inflammatory-related factors, which causes destabilization of vessels and initiates vessel remodeling in cancer. (Review)
26462497 pro-angiogenic Tie-2-expressing monocytes (TEM) and endothelial progenitor cells (EPC) play a crucial role in Critical limb ischemia.
26319232 we report the analysis of a comprehensive collection of 22 TIE2 mutations identified in patients with vascular morphogenesis
26269515 we show that VEGFA signaling from TIE2(hi) TMEM macrophages results in local, transient vascular permeability and tumor cell intravasation.
26258417 Rapamycin improves TIE2-mutated venous malformation
26115772 Data indicate that vascular malformations (VMs) are mediated by mutations in receptor tyrosine kinase Tie2 (TEK).
25909285 Data indicate that foretinib suppresses angiogenesis and lymphangiogenesis by blocking vascular endothelial growth factor receptors
25552591 Genetic variation contributes to the interindividual variation in growth factor levels and explains a modest proportion of circulating hepatocyte growth factor, Ang-2, and Tie-2.
25374184 Tie-2 expression in colorectal cancer is much higher and valuable for assessing the prognosis.
25180601 VE-PTP activates TIE2 and stabilizes retinal and choroidal blood vessels
25047691 increased placental expression in pregnancies with preeclampsia with and without intrauterine growth restriction
24976393 TIE-2 levels were changed at the organ level in lethal sepsis.
24966004 This study provided strong evidence supporting the disorganized vascular structures and dysregulation of related molecules in sporadic VMs.
24947924 The data show that angiopoietin 1 and Tie2 concentrations identify a subgroup of patients who benefit from bevacizumab
24376824 sTie2 levels were significantly higher in the cord blood for gestational diabetes mellitus subjects (3869 +/- 370 ng/L) compared to controls.
24333662 CD14(bright)CD16(low) intermediate monocytes expressing Tie2 are increased in the peripheral blood of patients with primary myelofibrosis.
24308939 DUSP1, DUSP4, and DUSP5 differentially modulate endothelial MAPK signaling pathways downstream of Tie-2 receptors.
24254563 Higher baseline TIE-2 and VEGF levels are related and worsen survival in cancer patients
24023872 Twist1-Tie2-Angs signaling is important for controlling vascular permeability
23982963 Local engagement of synovial TIE-2 is observed during the earliest phases of rheumatoid arthritis, suggesting that TIE-2 signaling may contribute to disease development and progression or may indicate an attempt to protect against these processes.
23840065 identify a unique dual role for Abl kinases in the regulation of angiopoietin/Tie2 protein kinase signaling
23770419 Tie1 is critical for reducing Ang1-induced Tie2 activity and angiogenesis
23754286 Lactate engaged the PI3K/Akt pathway via ligand-mediated activation of the three receptor tyrosine kinases Axl, Tie2, and VEGF receptor 2.
23754070 Knockdown of c-Cbl reversed SAHAinduced Tie2 protein degradation.
23652985 Ang1,ang2 and Tie-2 form a signaling axis key to the vascular dyshomeostasis that underlies sepsis. [review]
23633549 TIE2-mutant endothelial cells are deficient in the production of PDGFB.
23566851 Our results identified two novel Tie2 gene polymorphisms with genetic susceptibility to VMs, although future functional validation of the two polymorphisms is warranted in the future.
23504320 ligand-independent dimerization of Tie2 is essential for a strong response upon stimulation with high dose Ang1.
23190105 This article summarizes recent advances in pericyte study in conjunction with ANG1/ANG2-Tie-2 signaling and also discuss possible therapeutic strategies for diabetic retinopathy by targeting pericytes through manipulating ANG1/ANG2-Tie-2 signaling.
23174599 Ang-2, Tie-2 and VEGFR-2 are involved in the development, invasion, metastasis, and prognosis of colorectal cancer, and play important roles in angiogenesis.
23149917 our findings indicate that Ang2 plays a protective role in tumor endothelial cells by activating Tie2
23123737 The ANGPTs/Tie-2 system shows greater biological activity in both human and a rat model of ovarian hyperstimulation syndrome.
23086340 This work reveals an anti-angiogenic role of STAT1 activation that acts in Tie2-R849W-expressing endothelial cells to impair VEGF-A-mediated STAT3 signaling, bFGF production, and smooth muscle cell recruitment.
22996814 increased Tie2 expression, via Akt-FOXO1 pathway activation, may play an important role in IMH pathogenesis.
22848540 LRP5-Tie2-Ang signaling axis plays a central role in control of both angiogenesis and alveolarization during postnatal lung development
22836649 study concludes that VEGF R1 and Tie-2 receptors may play important role in lung cancer development and their receptor concentrations may reflect the patients' response to treatment.
22728324 plasma concentration of Ang-2 and Tie-2 were significantly higher in colon cancer patientscompared to controls
22621187 The R849W mutation in TIE2 could be one of the major causes for cutaneomucosal venous malformations in Asian families.
22585576 a contextual model whereby differential TIE2 and integrin expression, binding, and activation control the role of ANG-2 in angiogenesis.
22465760 Decreased soluble TGF-beta1, Tie-2, and angiopoietins serum levels in bone marrow after treating healthy donors with granulocyte colony-stimulating factor.
22449617 Concentrations of Ang-2 and Tie-2 were significantly higher in patients with gastric cancer than controls, while concentrations of Ang-1 were not statistically different between the groups.
22408401 the positive correlation between Ang-2 and Tie-2 levels in metastatic subjects, implies that cases with a Tie-2 level above the upper limits, together with higher level of Ang-2 seem to be highly predictive of metastases.
22342979 these results suggest that the expression level of Tie1 and its physical interaction with Tie2 defines whether Ang2 functions as a Tie2 agonist or antagonist, thereby determining the context-dependent differential endothelial sensitivity to Ang2.
22326430 Upregulation of shear stress-induced Tie2-dependent signaling contributes to enhanced in vivo reendothelialization capacity of human endothelial progenitor cells.
22235284 the effects of factors activating ectodomain cleavage on both Tie1 and Tie2 within the same population of cells, and their impact on angiopoietin signalling
21962923 Our study revealed that somatic mutations in exon 17 of the TEK gene were more common in noninherited vascular anomalies than previously reported.
21884204 Angiopoietins and the Tie-2 receptor are not related to known prognostic indicators in invasive breast cancer.
21858161 Data show that TLR2 activation promotes angiogenesis, cell adhesion and invasion, effects that are in part mediated through the Tie2 signalling pathway, key mechanisms involved in the pathogenesis of RA.
21849906 Sera Ang-1 and Ang-2, and Tie-2 as well as variants of 4G/5G of PAI-1 polymorphism have positive implications in the pathogenesis of preeclampsia
21672190 Tie-2 levels did not differ significantly between controls and acute myocardial infarction patients.
21576085 Studies suggest that the combined targeting of angiogenic ECs and proangiogenic TEMs by selective ANG2/TIE2-pathway inhibitors may extend the reach of vascular-targeting therapies in cancer patients.
21575447 There was no difference in TIE2 expression between patients with pre-eclampsia and controls.
21525162 Our data suggest, for the first time, an interaction between VEGF and Tie2 in uterine endothelial cells and a potential mechanism for the decrease in circulating sTie2 levels in preeclampsia, likely through inhibition of VEGF signaling.
21400522 High TIE-2 is associated with papillary thyroid carcinoma.
21368233 Expression of angiopoietin 2 receptor TIE2 defines a highly proangiogenic subpopulation of myeloid cells in circulation and tumors called TIE2-expressing monocytes/macrophages.
21366713 serum sTie2 levels may serve as a useful marker for SSc-related PAH, contributing to early diagnosis and therapeutic intervention
21321379 Tie2 signaling in glioma cells regulates the cross-talk between glioma cells and tumor microenvironment, envisioning Tie2 as a multi-compartmental target for glioma therapy.
21273558 Monocytes and endothelial cells form a unique Tie2/angiopoietin-1 signaling system that affects endothelial cell survival and may play critical a role in vascular remodeling and homeostasis.
21212269 the Ang1/Tie2 signal potentiates basal Notch signal controlling vascular quiescence by up-regulating Dll4 through AKT-mediated activation of beta-catenin.
21173154 APC activates Tie2, via a mechanism requiring, in sequential order, the receptors, endothelial protein C receptor, protease-activated receptor-1, and EGF receptor, which selectively enhances the PI3K/Akt signaling to enhance junctional complexes
21097670 Epithin, which regulates endothelial Tie2 functions, plays a critical role in the fine tuning of transendothelial migration for normal and cancer cells.
21042788 Ang-1, Ang-2 and Tie-2 mRNA expression and protein levels were measured in bronchoalveolar lavage fluid pellets and supernatants of patients with IPF.
20696814 Data suggest that the Ang/Tie-2 system is involved in the growth and development of metastases of GEP-NETs, and that favors the recruitment of Tie-2(+) monocytes to the tumor site.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20519501 the Tie2/alphavbeta3 integrin association-induced integrin internalization and degradation are mechanistic consequences of endothelial Ang-2 stimulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20348331 Soluble Tie-2 was positively associated with body mass index, diabetes, and triglycerides but was inversely related to age, alcohol consumption, and glomerular filtration rate.
20227369 Provide evidence for Tie1-Tie2 complex formation on the cell surface and identify molecular surface areas essential for recognition. The Tie1-Tie2 interactions are dynamic, inhibitory, and differentially modulated by angiopoietin-1 and -2.
20191124 Tie2 expression in human embryonic tissue.
20164029 The Tie-2 immunoreactivity was dominantly observed in the heamangiogenic cells and cells cords, whereas the matured villi showed immunoreactivity only in other components.
20099495 Plasma concentrations of Ang-1 (angiopoietin 1), Ang-2 (angiopoietin 2), Tie-2 receptor and Ang-1/Ang-2 ratios were significantly higher in cervical cancer patients than in controls
20056911 An autocrine linkage between the endothelial protein kinase C-MMP-14 axis and Tie-2 shedding was shown to be a novel regulatory mechanism for the Ang-Tie-2 system and may play a role in modulating endothelial function during angiogenesis.
20054548 The soluble domain of the Tie2 receptor predicts outcome in patients with acute myeloid leukemia undergoing allogeneic hematopoietic stem cell transplantation.
20026268 Mutation of Y1111 to phenylalanine (Y1111F) results in an increase in receptor phosphorylation and kinase activity, as well as increased downstream signaling.
19888299 Hereditary cutaneomucosal venous malformations are caused by TIE2 mutations with widely variable hyper-phosphorylating effects.
19875484 Maternal serum angiopoietin-1 and -2 and tie-2 in early pregnancy ending in preeclampsia or intrauterine growth retardation.
19733541 Ang1/Tie-2 signaling regulates myogenic precursor cell self-renewal by controlling the return to quiescence of a subset of satellite cells.
19689429 Angiopoietin-1-induced ubiquitylation of Tie2 by c-Cbl is required for internalization and degradation.
19674970 GATA3 is indispensable for Ang-1-Tie2-mediated signaling in large vessel endothelial cells
19576253 Report a synthetic peptide mediated active targeting of cisplatin liposomes to Tie2 expressing cells.
19543148 clinical data support in vivo shedding of sTie2 through VEGF signaling upon pulmonary vascular injury. Soluble Tie2 did not affect the association between Ang-1 or Ang-2 and the pulmonary leak index.
19515812 Shock-induced stress induces loss of microvascular endothelial Tie2 in the kidney which is not associated with reduced glomerular barrier function.
19487284 The Ang1/Tie2 signals contribute to tumor progression by increasing vascular entry and exit of tumor cells to facilitate tumor dissemination and establishment of metastases.
19424712 these results suggest that one pathway mediating the internalization of Tie2 in response to Ang1 is through clathrin-coated pits.
19421150 Results show that downmodulation of ABCG2 or ABCC2 resulted in the inability of Tie2 activation to induce a chemoresistant phenotype.
19351722 The Ang/Tie-2 system may have an important role in the recruitment of monocytes to the thyroid gland and the pathogenesis of the tissue damage seen in autoimmune thyroid disorders.
19340004 study shows expression of a mutated gene found in an acute myeloid leukemia (AML) patient, TEKG743A, confers hypersensitivity to growth factor & increased phosphorylation of mitogenic signaling pathways in human AML cell line, but not in murine pro-B line
19339208 Results suggest that proper oligomerization of Angiopoietin 2 is a critical determinant of its binding and activation of Tie2.
19223473 Ang2 functions as a Tie2 agonist when Ang1 is absent but as a dose-dependent antagonist when Ang1 is present
19116766 These results reveal a novel role for HPTPbeta in modulating Ang-1-Tie2 signaling and endothelial cell survival.
19082594 HSC mobilization from their niches by GCSF resulted in higher VEGF serum livels, lower Tie-2 serum levels, and no change in angiopoietin 1 and angiopoietin 2 levels
19079259 These data show that a sporadic disease may be explained by somatic changes in a gene causing rare, inherited forms and pinpoint TIE2 pathways as potential therapeutic targets for venous malformations.
19079259 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18807212 Soluble extracellular decreased serum level of Tie2 is associated with bladder cancer.
18675456 the strongest immunoreactivity for Tie-2 observed in cytotrophoblasts, ACC and endothelial cells of the very early human placenta.
18570117 Patients with preeclampsia and those with small-for-gestational-age fetuses have lower plasma soluble Tie-2 than women with normal pregnancies.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18425120 Data show that Angiopoietin 1 bridges Tie2 at cell-cell contacts, resulting in trans-association of Tie2 in the presence of cell-cell contacts, while in isolated cells extracellular matrix-bound Ang1 locates Tie2 at cell-substratum contacts.
18425119 Data show that Angiopoietin 1 induces unique Tie2 complexes in mobile and confluent endothelial cells.
18401423 Although STAT1 phosphorylation required JNK and p38MAPK activation, only JNK activation was essential for IRF1 promoter activation by Tie2-R849W.
18269030 The expression of Ang2 and Tie2 was higher markedly in proliferating hemangiomas than in involuting hemangiomas, and was rare or negative in normal skin.
17901375 VEGF regulates angiopoietin-Tie2 signaling by inducing proteolytic cleavage and shedding of Tie2 via a novel PI3K/Akt-dependent pathway.
17728252 Activation of Tie1 ectodomain cleavage increases cartilage oligomeric protein angiopoietin 1 activation of Tie2.
17724803 Results describe the expression of angiopoietin-1, 2 and 4 and Tie-1 and 2 in gastrointestinal stromal tumors, leiomyomas and schwannomas.
17704802 First report on role of angiopoietin 2/Tie2 in regulation of HIF-1 alpha/vascular endothelial growth factor (VEGF) expression provides additional evidence of intrinsic coordination that occurs among these factors during angiogenesis.
17562701 Ang-1 phosphorylates Tie-2 and its downstream effector phosphatidylinositol 3-kinase. This induces activation of one endogenous GTPase, Rac1, and inhibition of another, RhoA
17513791 Tie-2-expressing monocytes (but not lymphocytes or granulocytes) present in human peripheral blood respond to angiopoietin-2 with both chemotaxis and altered cytokine release.
17504972 Data show that angiopoietin 1 induces Tie1 phosphorylation in endothelial cells, and that this phosphorylation is Tie2 dependent.
17446561 Tie-2(+) AMLs in endothelial culture medium supplemented with VEGF and angiopoietins resulted in their partial endothelial differentiation.
17327411 TIE2 expression in human blood monocytes (TEMs)identifies a distinct subset of monocytes that represent the main monocyte population in the blood and tumors of cancer patients. Purified TEMs, but not TEM-depleted monocytes, markedly promoted angiogenesis.
17322632 the relationship of angiopoietin-1, angiopoietin-2 and tie-2 to coronary collateral formation in patients with coronary artery disease
17258205 Foxo-1 and Ang-2/Tie2 are part of the molecular response to shear stress, which may regulate angiogenesis.
17035633 Screening for Wnt5a-regulated genes in cultured endothelial cells identified several encoding angiogenic regulators, including matrix metalloproteinase-1, an interstitial collagenase, and Tie-2, a receptor for angiopoietins.
16978614 Circulating levels of Ang-2 and sTie-2 receptor were detectable but invariant in women during COS cycles.
16978237 sAng-2 and sTie-2 play a role in progression of some haematological malignancies
16956819 Tie2 was significantly overexpressed in leukemic blasts
16895971 findings demonstrate that in response to angiopoietin-1, Tie2 is rapidly internalized & targeted for degradation; angiopoietin-2 only weakly activated Tie2 & did not significantly stimulate receptor internalization, while mildly inducing Tie2 degradation
16830384 Dominant Ang-2 expression against Ang-1 through Tie2 receptor in the presence of VEGF plays a critical role in initiating early neovascularization and transformation of noncancerous liver to hepatocellular carcinoma.
16756945 present study identifies ShcA as a mediator of the anti-apoptotic activity of venous malformation -mutant Tie2
16723371 Results showed that Tie-2 mRNA and protein expression from the eutopic endometrium did not differ significantly between endometriosis patients and normal controls.
16614513 expression of Ang-1 and Ang-2 is important for gastric tumor angiogenesis, and a possible autocrine/paracrine function of the angiopoietin/Tie2 system is involved in gastric cancer progression
16458662 Participation of down-regulated TIE-2 in the placental tissues may indicate a role for this angiogenic factor in the development of placenta accreta.
16457819 the uORFs within the Tie2 5' UTR serve to decrease the percent of ribosomes competent for reinitiation as these traverse the mRNA 5' UTR, thus minimizing interference with the internal ribosome entry site
16157706 Stable interaction between integrin alpha5beta1 and Tie2 receptor regulates endothelial cell response to Ang-1.
16049136 activation of tie-2 receptors by Ang-1 triggers the production of ROS through activation of NADPH oxidase
16037627 sTie-2 increased significantly in the AMI patients; viability of HUVECs and tube formation area measured after stimulated with recombinant Tie-2/Fc chimera were observed to decrease, suggesting angiogenesis might be inhibited
16020388 Tie-2 receptor is expressed by human neutrophils whose active site ligation with either angiopoietin-1 or angiopoietin-2 exerts migratory effects on the one hand and arrests VEGF-mediated chemotaxis on the other
15985432 an important role for a PECAM1-SHP2-Tie2 pathway in flow-mediated signal transduction.
15893943 In a series of immunohistochemical analysis on human ovarian tissues, there was a unique localization of Tie-2 to the primary cilia of ovarian surface epithelium.
15893672 2.4 A crystal structure of the Angiopoietin-2 (Ang2) receptor binding region was determined.
15817662 sTie2 did not reduce goiter mass or vascular volume when used alone but was essential for complete goiter inhibition.
15802272 Tie2 mediates internal translation initiation
15781448 the isolated receptor-binding domain of Ang1 is capable of mediating some effects of full-length Ang1 independently of Tie2 phosphorylation, possibly through integrin ligation
15769741 proper oligomerization of Ang1 having at least four subunits by the intermolecular disulfide linkage involving cysteines 41 and 54 is critical for Tie2 binding and activation
15746084 Ang1 has a role in lymphatic vessel endothelial proliferation, Tie2 expression, and VEGFR-3 upregulation
15536413 angiopoietin 1 stimulates directed migration and possibly inhibits vascular endothelial growth factor-induced eosinophil chemotaxis via its Tie-2 receptor.
15377998 a mutation of glycine to aspartic acid at the second glycine of the GXGXXG motif of Tie2 (G833DTie2) in human intramuscular haemangiomas (IMHs) of the capillary type
15370298 The Ang-Tie2 system appears to have an autoregulatory feedback system that may be regulating the overall activity of the Tie2 system in both physiological and pathological conditions.
15297853 Angiopoetin-Tie2 autocrine pathway works in primary acute meylocytic leukemia cells or not by using soluble Tie2-Fc, which inhibits Angiopoietins from binding to Tie2 receptor.
15242771 Blocking Akt function abolishes angiopoietin 1 (Ang1), a ligand for Tie2, mediated EC survival, and activating Akt rescues a Tie2 blockade-induced EC apoptosis.
15210451 Tie-2 signaling synergistically amplifies and participates in TNF-alpha-mediated angiogenesis.
14991534 Tie-2/Tek expression proved more sensitive than CD31 expression in terms of prognostic significance
14991531 The autocrine/paracrine signaling of the Ang/Tie2 system is important for the up-regulated angiogenesis in the RA synovium, as well as for synoviocyte behavior, by regulating chemotactic cell movement.
14726409 In advanced arteriosclerotic lesions, the activation of the Tie2-mediated STAT5 signaling pathway may negatively regulate vessel growth.
14665640 there is a novel interaction between Tie2 with the adapter molecule ShcA that may play a role in the regulation of migration and three-dimensional organization of endothelial cells induced by angiopoietin-1
13130465 Tie2 signaling is an important angiogenic mediator that links the proinflammatory cytokine TNF alpha to pathologic angiogenesis.
12887596 presence of Tie-2 in human peripheral and autonomic nervous tissue, suggesting a role for Tie-2 in neural tissue.
12878859 Tie2 up-regulation is associated with infiltrating breast carcinoma
12816861 Angiopoietin-1 is implicated in the maturation and remodeling of the vascular network during embryo development and in adult life through its tyrosine kinase receptor Tie-2 stimulates endothelial cells to migrate and change shape.
12731667 comparison of the hematopoietic and angiogenic abilities of human cord blood CD34+TEK+ and CD34+TEK- cells using a clonogenic assay and xenotransplantation into immunodeficient NOD/SCID mice showing TEK plays a crucial role
12711329 Shear stress activates Tie2 receptor tyrosine kinase in vascular endothelial cells.
12665569 tyrosine residue 1106 on Tie2 is critical for coupling downstream cell migration signal transduction pathways with Angiopoietin 1 stimulation in endothelial cells
12609966 Endothelial Tie2 interacts with ABIN-2.
12419314 expression and function of TIE2 in hematopoietic stem cells in cord blood
12138242 results indicate that there is a difference in the Ang/Tie2 gene expression between physiological and pathological angiogenesis in the ovary.
11967990 expression of NERF2 was increased under hypoxia and that this increase temporally correlated with the increase in Tie2 expression. Hypoxia-induced expression of NERF2 and Tie2 was blocked by angiopoietin-2, a competitive inhibitor of angiopoietin-1
11866538 Vascular endothelial growth factor modulates the Tie-2:Tie-1 receptor complex
11824375 Role of Tie2 in the differentiation of endothelial cells during angiogenesis.
11733376 Tie2 mRNA and protein were up-regulated in the pathogenesis of hemangioma.

AA Sequence

MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQD      1 - 70
PLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVN     71 - 140
ISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRR    141 - 210
CEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFC    211 - 280
LPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTP    281 - 350
KIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG    351 - 420
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYE    421 - 490
AWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLN    491 - 560
LTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLT    561 - 630
AWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLK    631 - 700
GLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIIL    701 - 770
QLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK    771 - 840
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNL    841 - 910
LDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKI    911 - 980
ADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK    981 - 1050
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSA   1051 - 1120
EEAA                                                                     1121 - 1124
//

Text Mined References (217)

PMID Year Title
26858516 2015 Involvement of Angiopoietin-2 and Tie2 Receptor Phosphorylation in STEC-HUS Mediated by Escherichia coli O104:H4.
26659448 2015 Tie2 Signaling Enhances Mast Cell Progenitor Adhesion to Vascular Cell Adhesion Molecule-1 (VCAM-1) through ?4?1 Integrin.
26642851 2015 Interfering with VE-PTP stabilizes endothelial junctions in vivo via Tie-2 in the absence of VE-cadherin.
26489611 2015 Tie-1: A potential target for anti-angiogenesis therapy.
26462497 2016 Inflammation is associated with a reduced number of pro-angiogenic Tie-2 monocytes and endothelial progenitor cells in patients with critical limb ischemia.
26319232 2015 Common and specific effects of TIE2 mutations causing venous malformations.
26269515 2015 Real-Time Imaging Reveals Local, Transient Vascular Permeability, and Tumor Cell Intravasation Stimulated by TIE2hi Macrophage-Derived VEGFA.
26258417 2015 Rapamycin improves TIE2-mutated venous malformation in murine model and human subjects.
26115772 2015 Classification and Tie2 mutations in spinal and soft tissue vascular anomalies.
25909285 2015 Foretinib inhibits angiogenesis, lymphangiogenesis and tumor growth of pancreatic cancer in vivo by decreasing VEGFR-2/3 and TIE-2 signaling.
25552591 2015 Genome-wide association study for endothelial growth factors.
25374184 2014 Expression of Ang-2/Tie-2 and PI3K/AKT in colorectal cancer.
25180601 2014 Targeting VE-PTP activates TIE2 and stabilizes the ocular vasculature.
25047691 2014 Placental mRNA expression of angiopoietins (Ang)-1, Ang-2 and their receptor Tie-2 is altered in pregnancies complicated by preeclampsia.
24976393 2014 The renal angiopoietin/Tie2 system in lethal human sepsis.
24966004 2014 Disorganized vascular structures in sporadic venous malformations: a possible correlation with balancing effect between Tie2 and TGF-?.
24947924 2014 The combination of circulating Ang1 and Tie2 levels predicts progression-free survival advantage in bevacizumab-treated patients with ovarian cancer.
24376824 2013 Increased endothelial inflammation, sTie-2 and arginase activity in umbilical cords obtained from gestational diabetic mothers.
24333662 2014 CD14(bright)CD16(low) intermediate monocytes expressing Tie2 are increased in the peripheral blood of patients with primary myelofibrosis.
24308939 2013 Regulation of angiopoietin-1/Tie-2 receptor signaling in endothelial cells by dual-specificity phosphatases 1, 4, and 5.
24254563 2013 Prognostic value of serum Tie-2 and vascular endothelial growth factor levels in cancer patients.
24023872 2013 Twist1 controls lung vascular permeability and endotoxin-induced pulmonary edema by altering Tie2 expression.
23982963 2013 Local synovial engagement of angiogenic TIE-2 is associated with the development of persistent erosive rheumatoid arthritis in patients with early arthritis.
23840065 2013 Abl kinases are required for vascular function, Tie2 expression, and angiopoietin-1-mediated survival.
23770419 2013 Hypoxia reduces endothelial Ang1-induced Tie2 activity in a Tie1-dependent manner.
23754286 2013 Lactate engages receptor tyrosine kinases Axl, Tie2, and vascular endothelial growth factor receptor 2 to activate phosphoinositide 3-kinase/Akt and promote angiogenesis.
23754070 2013 Inhibition of proliferation, sprouting, tube formation and Tie2 signaling of lymphatic endothelial cells by the histone deacetylase inhibitor SAHA.
23652985 2013 Dysregulation of the angiopoietin-Tie-2 axis in sepsis and ARDS.
23633549 2013 Venous malformation-causative TIE2 mutations mediate an AKT-dependent decrease in PDGFB.
23566851 2013 Association study between of Tie2/angiopoietin-2 and VEGF/KDR pathway gene polymorphisms and vascular malformations.
23504320 2013 Ligand-independent Tie2 dimers mediate kinase activity stimulated by high dose angiopoietin-1.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23190105 2012 Connection of pericyte-angiopoietin-Tie-2 system in diabetic retinopathy: friend or foe?
23174599 2012 [Role of Ang-2, Tie-2 and VEGFR-2 in angiogenesis in colorectal carcinoma and their prognostic value].
23149917 2013 Angiopoietin-2 functions as a Tie2 agonist in tumor models, where it limits the effects of VEGF inhibition.
23123737 2013 Involvement of the ANGPTs/Tie-2 system in ovarian hyperstimulation syndrome (OHSS).
23086340 2013 STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.
22996814 2013 Isolation and characterization of endothelial cells from intramuscular hemangioma.
22848540 2012 LRP5 regulates development of lung microvessels and alveoli through the angiopoietin-Tie2 pathway.
22836649 2013 sVEGF R1 and Tie-2 levels during chemotherapy of lung cancer patients.
22728324 2012 Plasma concentrations of angiopoietin-1, angiopoietin-2 and Tie-2 in colon cancer.
22621187 2012 Cutaneomucosal venous malformations are linked to the TIE2 mutation in a large Chinese family.
22585576 2012 Angiopoietin-2 differentially regulates angiogenesis through TIE2 and integrin signaling.
22465760 2012 Decreased soluble TGF-?1, Tie-2, and angiopoietins serum levels in bone marrow after treating healthy donors with granulocyte colony-stimulating factor.
22449617 2012 Plasma concentrations of Ang-1, Ang-2 and Tie-2 in gastric cancer.
22408401 2012 Elevated peripheral blood plasma concentrations of tie-2 and angiopoietin 2 in patients with neuroendocrine tumors.
22342979 2012 Tie1 regulates the Tie2 agonistic role of angiopoietin-2 in human lymphatic endothelial cells.
22326430 2012 Shear stress-induced activation of Tie2-dependent signaling pathway enhances reendothelialization capacity of early endothelial progenitor cells.
22235284 2012 The molecular balance between receptor tyrosine kinases Tie1 and Tie2 is dynamically controlled by VEGF and TNF? and regulates angiopoietin signalling.
21962923 2011 Somatic mutations in exon 17 of the TEK gene in vascular tumors and vascular malformations.
21884204 2011 Angiopoietins 1 and 2 and Tie-2 receptor expression in human ductal breast disease.
21858161 2011 Toll-like receptor 2 induced angiogenesis and invasion is mediated through the Tie2 signalling pathway in rheumatoid arthritis.
21849906 2011 Do serum angiopoietin-1, angiopoietin-2, and their receptor Tie-2 and 4G/5G variant of PAI-1 gene have a role in the pathogenesis of preeclampsia?
21672190 2011 Circulating angiopoietins-1 and -2, angiopoietin receptor Tie-2 and vascular endothelial growth factor-A as biomarkers of acute myocardial infarction: a prospective nested case-control study.
21576085 2011 Angiopoietin-2 TIEs up macrophages in tumor angiogenesis.
21575447 2011 [Correlation of angiopoietin-2 and angiopoietin-2 receptor expressions in serum and placenta with preeclampsia].
21525162 2011 Decreased circulating soluble Tie2 levels in preeclampsia may result from inhibition of vascular endothelial growth factor (VEGF) signaling.
21400522 2011 Vascular endothelial growth factors and angiopoietins in presentations and prognosis of papillary thyroid carcinoma.
21368233 2011 Angiopoietin 2 stimulates TIE2-expressing monocytes to suppress T cell activation and to promote regulatory T cell expansion.
21366713 2011 Serum Tie2 levels: clinical association with microangiopathies in patients with systemic sclerosis.
21321379 2010 Tie2/TEK modulates the interaction of glioma and brain tumor stem cells with endothelial cells and promotes an invasive phenotype.
21273558 2011 Primary monocytes regulate endothelial cell survival through secretion of angiopoietin-1 and activation of endothelial Tie2.
21212269 2011 Angiopoietin-1/Tie2 signal augments basal Notch signal controlling vascular quiescence by inducing delta-like 4 expression through AKT-mediated activation of beta-catenin.
21173154 2011 Activated protein C enhances human keratinocyte barrier integrity via sequential activation of epidermal growth factor receptor and Tie2.
21097670 2011 Epithin/PRSS14 proteolytically regulates angiopoietin receptor Tie2 during transendothelial migration.
21042788 2010 Investigation of angiogenetic axis Angiopoietin-1 and -2/Tie-2 in fibrotic lung diseases: a bronchoalveolar lavage study.
20708158 2010 Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage.
20696814 2010 The association of the angiopoietin/Tie-2 system with the development of metastasis and leukocyte migration in neuroendocrine tumors.
20651738 2010 Targeting the ANGPT-TIE2 pathway in malignancy.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20519501 2010 Angiopoietin-2 stimulation of endothelial cells induces alphavbeta3 integrin internalization and degradation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20348331 2010 Clinical and genetic correlates of circulating angiopoietin-2 and soluble Tie-2 in the community.
20227369 2010 Tie1-Tie2 interactions mediate functional differences between angiopoietin ligands.
20191124 2010 Tie2 expression in human embryonic tissues.
20164029 2009 Expression of VEGF receptors VEFGR-1 and VEGFR-2, angiopoietin receptors Tie-1 and Tie-2 in chorionic villi tree during early pregnancy.
20099495 2009 Plasma concentration of angiopoietin-1, angiopoietin-2 and Tie-2 in cervical cancer.
20056911 2010 An autocrine linkage between matrix metalloproteinase-14 and Tie-2 via ectodomain shedding modulates angiopoietin-1-dependent function in endothelial cells.
20054809 2010 Angiopoietin-1/Tie2 receptor signaling in vascular quiescence and angiogenesis.
20054548 2010 Shedding of the endothelial receptor tyrosine kinase Tie2 correlates with leukemic blast burden and outcome after allogeneic hematopoietic stem cell transplantation for AML.
20026268 2010 A negative regulatory role for Y1111 on the Tie-2 RTK.
19922791 2010 Effects of angiopoietins-1 and -2 on the receptor tyrosine kinase Tie2 are differentially regulated at the endothelial cell surface.
19888299 2010 Hereditary cutaneomucosal venous malformations are caused by TIE2 mutations with widely variable hyper-phosphorylating effects.
19875484 2010 Maternal serum angiopoietin-1 and -2 and tie-2 in early pregnancy ending in preeclampsia or intrauterine growth retardation.
19854647 2009 Novel thienopyrimidine and thiazolopyrimidine kinase inhibitors with activity against Tie-2 in vitro and in vivo.
19733541 2009 Autocrine and paracrine angiopoietin 1/Tie-2 signaling promotes muscle satellite cell self-renewal.
19689429 2009 Angiopoietin-1-induced ubiquitylation of Tie2 by c-Cbl is required for internalization and degradation.
19674970 2009 Critical role for GATA3 in mediating Tie2 expression and function in large vessel endothelial cells.
19615361 2009 Lipid rafts serve as signaling platforms for Tie2 receptor tyrosine kinase in vascular endothelial cells.
19576253 2009 A synthetic peptide mediated active targeting of cisplatin liposomes to Tie2 expressing cells.
19543148 2010 The interaction of soluble Tie2 with angiopoietins and pulmonary vascular permeability in septic and nonseptic critically ill patients.
19515812 2009 Shock-induced stress induces loss of microvascular endothelial Tie2 in the kidney which is not associated with reduced glomerular barrier function.
19487284 2009 Angiopoietin-1 overexpression modulates vascular endothelium to facilitate tumor cell dissemination and metastasis establishment.
19451274 2009 VE-PTP controls blood vessel development by balancing Tie-2 activity.
19424712 2009 Oligomerized Tie2 localizes to clathrin-coated pits in response to angiopoietin-1.
19421150 2009 Tie2-mediated multidrug resistance in malignant gliomas is associated with upregulation of ABC transporters.
19351722 2009 Tie-2 is overexpressed by monocytes in autoimmune thyroid disorders and participates in their recruitment to the thyroid gland.
19340004 2009 Functional characterization of an activating TEK mutation in acute myeloid leukemia: a cellular context-dependent activating mutation.
19339208 2009 A designed angiopoietin-2 variant, pentameric COMP-Ang2, strongly activates Tie2 receptor and stimulates angiogenesis.
19293632 2009 Tie2 is tied at the cell-cell contacts and to extracellular matrix by angiopoietin-1.
19234476 2009 Control of vascular morphogenesis and homeostasis through the angiopoietin-Tie system.
19223473 2009 Angiopoietin 2 is a partial agonist/antagonist of Tie2 signaling in the endothelium.
19186995 2009 The paracrine role of Tie-2-expressing monocytes in tumor angiogenesis.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19116766 2009 Tyrosine phosphatase beta regulates angiopoietin-Tie2 signaling in human endothelial cells.
19082594 2009 Changes in vascular endothelial growth factor, angiopoietins, and Tie-2 levels with G-CSF stimulation in healthy donors.
19079259 2009 Somatic mutations in angiopoietin receptor gene TEK cause solitary and multiple sporadic venous malformations.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18807212 2009 Serum levels of angiogenic factors and their prognostic relevance in bladder cancer.
18675456 2008 The distribution of angiopoietin-1, angiopoietin-2 and their receptors tie-1 and tie-2 in the very early human placenta.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18570117 2008 Preeclampsia and small-for-gestational age are associated with decreased concentrations of a factor involved in angiogenesis: soluble Tie-2.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18425120 2008 Differential function of Tie2 at cell-cell contacts and cell-substratum contacts regulated by angiopoietin-1.
18425119 2008 Angiopoietins assemble distinct Tie2 signalling complexes in endothelial cell-cell and cell-matrix contacts.
18401423 2008 Tie2-R849W mutant in venous malformations chronically activates a functional STAT1 to modulate gene expression.
18366015 2008 Tie2: a journey from normal angiogenesis to cancer and beyond.
18269030 2007 [Expression and significance of Ang1, Ang2 and receptor Tie2 in hemangioma].
17901375 2007 VEGF induces Tie2 shedding via a phosphoinositide 3-kinase/Akt dependent pathway to modulate Tie2 signaling.
17728252 2007 Regulated proteolytic processing of Tie1 modulates ligand responsiveness of the receptor-tyrosine kinase Tie2.
17724803 2007 Expression of angiopoietin-1, 2 and 4 and Tie-1 and 2 in gastrointestinal stromal tumor, leiomyoma and schwannoma.
17704802 2008 Angiopoietin-2 decreases vascular endothelial growth factor expression by modulating HIF-1 alpha levels in gliomas.
17562701 2007 Angiopoietin-1 requires p190 RhoGAP to protect against vascular leakage in vivo.
17513791 2007 Expression of Tie-2 by human monocytes and their responses to angiopoietin-2.
17504972 2007 Activation of the orphan endothelial receptor Tie1 modifies Tie2-mediated intracellular signaling and cell survival.
17446561 2007 Expression of Tie-2 and other receptors for endothelial growth factors in acute myeloid leukemias is associated with monocytic features of leukemic blasts.
17350837 2007 Synthesis, structural analysis, and SAR studies of triazine derivatives as potent, selective Tie-2 inhibitors.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17327411 2007 Identification of proangiogenic TIE2-expressing monocytes (TEMs) in human peripheral blood and cancer.
17322632 2007 Angiopoietin-1, angiopoietin-2 and tie-2 in the coronary circulation of patients with and without coronary collateral vessels.
17258205 2007 Regulation of Foxo-1 and the angiopoietin-2/Tie2 system by shear stress.
17253678 2007 Evolution of a highly selective and potent 2-(pyridin-2-yl)-1,3,5-triazine Tie-2 kinase inhibitor.
17035633 2006 Wnt5a signaling induces proliferation and survival of endothelial cells in vitro and expression of MMP-1 and Tie-2.
16978614 2006 Circulating levels of total angiopoietin-2 and the soluble Tie-2 receptor in women during ovarian stimulation and early gestation.
16978237 2006 Differential levels of soluble angiopoietin-2 and Tie-2 in patients with haematological malignancies.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16956819 2006 Expression of angiopoietins and their receptor Tie2 in the bone marrow of patients with acute myeloid leukemia.
16895971 2006 Activation of Tie2 by angiopoietin-1 and angiopoietin-2 results in their release and receptor internalization.
16830384 2006 Expression of angiopoietins, Tie2 and vascular endothelial growth factor in angiogenesis and progression of hepatocellular carcinoma.
16756945 2006 Mutant Tie2 causing venous malformation signals through Shc.
16732286 2006 Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex.
16723371 2006 Angiopoietin-1, angiopoietin-2 and Tie-2 expression in eutopic endometrium in advanced endometriosis.
16614513 2006 Expression of angiopoietin 1, 2 and their common receptor Tie2 in human gastric carcinoma: implication for angiogenesis.
16458662 2006 Differential expression of angiopoietin-1, angiopoietin-2, and Tie receptors in placentas from pregnancies complicated by placenta accreta.
16457819 2006 The Tie2 5' untranslated region is inhibitory to 5' end-mediated translation initiation.
16157706 2005 Stable interaction between alpha5beta1 integrin and Tie2 tyrosine kinase receptor regulates endothelial cell response to Ang-1.
16049136 2005 Roles of reactive oxygen species in angiopoietin-1/tie-2 receptor signaling.
16037627 2005 Soluble angiopoietin receptor Tie-2 in patients with acute myocardial infarction and its effects on angiogenesis.
16020388 Angiopoietin affects neutrophil migration.
15985432 2005 Flow activates ERK1/2 and endothelial nitric oxide synthase via a pathway involving PECAM1, SHP2, and Tie2.
15893943 2005 Localization of the angiopoietin receptors Tie-1 and Tie-2 on the primary cilia in the female reproductive organs.
15893672 2005 Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition.
15851516 2005 Multiple angiopoietin recombinant proteins activate the Tie1 receptor tyrosine kinase and promote its interaction with Tie2.
15817662 2005 Complete inhibition of goiter in mice requires combined gene therapy modification of angiopoietin, vascular endothelial growth factor, and fibroblast growth factor signaling.
15802272 2005 Internal translation initiation mediated by the angiogenic factor Tie2.
15781448 2005 Effects of protein and gene transfer of the angiopoietin-1 fibrinogen-like receptor-binding domain on endothelial and vessel organization.
15769741 2005 Oligomerization and multimerization are critical for angiopoietin-1 to bind and phosphorylate Tie2.
15746084 2005 Angiopoietin-1 promotes lymphatic sprouting and hyperplasia.
15536413 2004 Expression and function of the angiopoietin receptor Tie-2 in human eosinophils.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15377998 2004 Transformation of vascular endothelial cells by a point mutation in the Tie2 gene from human intramuscular haemangioma.
15370298 Regulation of tie2 expression by angiopoietin--potential feedback system.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15297853 2004 Autocrine pathway of angiopoietins-Tie2 system in AML cells: association with phosphatidyl-inositol 3 kinase.
15284220 2004 Biological characterization of angiopoietin-3 and angiopoietin-4.
15242771 2004 Akt is a major angiogenic mediator downstream of the Ang1/Tie2 signaling pathway.
15210451 2004 Dual functional roles of Tie-2/angiopoietin in TNF-alpha-mediated angiogenesis.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14991534 2004 Long-term prognostic significance of neoangiogenesis in breast carcinomas: comparison of Tie-2/Tek, CD105, and CD31 immunocytochemical expression.
14991531 2004 Autocrine/paracrine role of the angiopoietin-1 and -2/Tie2 system in cell proliferation and chemotaxis of cultured fibroblastic synoviocytes in rheumatoid arthritis.
14749497 2004 Functional significance of Tie2 signaling in the adult vasculature.
14726409 2004 Angiopoietin 2 induces cell cycle arrest in endothelial cells: a possible mechanism involved in advanced plaque neovascularization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14665640 2004 Adaptor ShcA protein binds tyrosine kinase Tie2 receptor and regulates migration and sprouting but not survival of endothelial cells.
13130465 2003 Tie2 receptor tyrosine kinase, a major mediator of tumor necrosis factor alpha-induced angiogenesis in rheumatoid arthritis.
12887596 2003 Expression of Tie-2 in human peripheral and autonomic nervous system.
12878859 Blood markers for vasculogenesis increase with tumor progression in patients with breast carcinoma.
12816861 2003 Tie-2-dependent activation of RhoA and Rac1 participates in endothelial cell motility triggered by angiopoietin-1.
12731667 2003 Tunica interna endothelial cell kinase expression and hematopoietic and angiogenic potentials in cord blood CD34+ cells.
12711329 2003 Shear stress activates Tie2 receptor tyrosine kinase in human endothelial cells.
12665569 2003 A unique autophosphorylation site on Tie2/Tek mediates Dok-R phosphotyrosine binding domain binding and function.
12609966 2003 The antiinflammatory endothelial tyrosine kinase Tie2 interacts with a novel nuclear factor-kappaB inhibitor ABIN-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427764 2003 Angiopoietin-1 and angiopoietin-2 share the same binding domains in the Tie-2 receptor involving the first Ig-like loop and the epidermal growth factor-like repeats.
12419314 2002 Analysis of human TIE2 function on hematopoietic stem cells in umbilical cord blood.
12138242 2002 Expression of angiopoietin-1, angiopoietin-2, and Tie2 genes in normal ovary with corpus luteum and in ovarian cancer.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11967990 2002 NERF2, a member of the Ets family of transcription factors, is increased in response to hypoxia and angiopoietin-1: a potential mechanism for Tie2 regulation during hypoxia.
11866538 2002 Vascular endothelial growth factor modulates the Tie-2:Tie-1 receptor complex.
11806244 2001 Identification of a soluble form of the angiopoietin receptor TIE-2 released from endothelial cells and present in human blood.
11513602 2001 Mechanistic effects of autophosphorylation on receptor tyrosine kinase catalysis: enzymatic characterization of Tie2 and phospho-Tie2.
11397875 2001 Tie-2 is expressed on thyroid follicular cells, is increased in goiter, and is regulated by thyrotropin through cyclic adenosine 3',5'-monophosphate.
11080633 2000 Structure of the Tie2 RTK domain: self-inhibition by the nucleotide binding loop, activation loop, and C-terminal tail.
10995770 2000 Evidence for heterotypic interaction between the receptor tyrosine kinases TIE-1 and TIE-2.
10766762 2000 Characterization and expression of a novel alternatively spliced human angiopoietin-2.
10557082 1999 Functional interaction of vascular endothelial-protein-tyrosine phosphatase with the angiopoietin receptor Tie-2.
10521483 1999 Identification of Tek/Tie2 binding partners. Binding to a multifunctional docking site mediates cell survival and migration.
10369874 1999 Allelic and locus heterogeneity in inherited venous malformations.
10051567 1999 Angiopoietins 3 and 4: diverging gene counterparts in mice and humans.
10022833 1999 Socs1 binds to multiple signalling proteins and suppresses steel factor-dependent proliferation.
9764820 1998 The Tek/Tie2 receptor signals through a novel Dok-related docking protein, Dok-R.
9723709 1998 Characterization of TEK receptor tyrosine kinase and its ligands, Angiopoietins, in human hematopoietic progenitor cells.
9710115 1998 Tie2 receptor ligands, angiopoietin-1 and angiopoietin-2, modulate VEGF-induced postnatal neovascularization.
9660821 1998 Chemotactic properties of angiopoietin-1 and -2, ligands for the endothelial-specific receptor tyrosine kinase Tie2.
9204896 1997 Angiopoietin-2, a natural antagonist for Tie2 that disrupts in vivo angiogenesis.
8980225 1996 Vascular dysmorphogenesis caused by an activating mutation in the receptor tyrosine kinase TIE2.
8980224 1996 Requisite role of angiopoietin-1, a ligand for the TIE2 receptor, during embryonic angiogenesis.
8980223 1996 Isolation of angiopoietin-1, a ligand for the TIE2 receptor, by secretion-trap expression cloning.
8382358 1993 Molecular cloning and characterization of a novel receptor protein tyrosine kinase from human placenta.
7835909 1994 Assignment of the endothelial-specific protein receptor tyrosine kinase gene (TEK) to human chromosome 9p21.
7833915 1994 Assignment of a locus for dominantly inherited venous malformations to chromosome 9p.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7783168 1995 A gene for familial venous malformations maps to chromosome 9p in a second large kindred.
7545683 1995 Association of 75/80-kDa phosphoproteins and the tyrosine kinases Lyn, Fyn, and Lck with the B cell molecule CD20. Evidence against involvement of the cytoplasmic regions of CD20.
7478529 1995 GRB2 and SH-PTP2: potentially important endothelial signaling molecules downstream of the TEK/TIE2 receptor tyrosine kinase.
1312667 1992 A novel endothelial cell surface receptor tyrosine kinase with extracellular epidermal growth factor homology domains.