Property Summary

Ligand Count 168
NCBI Gene PubMed Count 231
PubMed Score 906.75
PubTator Score 636.09

Knowledge Summary

Patent (148,559)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Multiple cutaneous and mucosal venous malformations 10 0.0 5.0
Disease Target Count Z-score Confidence
Glaucoma 239 0.0 4.0

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.467 7.0e-07
astrocytic glioma -1.500 2.0e-02
cystic fibrosis 2.367 1.1e-04
ependymoma -1.500 2.7e-02
glioblastoma multiforme -1.200 1.8e-16
interstitial cystitis 2.000 1.3e-04
intraductal papillary-mucinous carcinoma... -2.000 1.3e-03
intraductal papillary-mucinous neoplasm ... -2.100 6.2e-03
invasive ductal carcinoma -2.000 7.6e-04
lung adenocarcinoma -2.600 1.8e-18
lung cancer -2.600 1.1e-04
lung carcinoma -2.700 3.0e-13
medulloblastoma, large-cell -2.100 3.0e-03
non-small cell lung cancer -3.024 6.8e-32
oligodendroglioma -1.500 1.1e-02
osteosarcoma -2.051 6.1e-03
ovarian cancer -1.300 3.6e-07
psoriasis 1.500 3.7e-04
ulcerative colitis 1.400 4.9e-05

Synonym

Accession Q02763 A8K6W0 B4DH20 B4DHD3 D3DRK5 E7EWI2 Q5TCU2 Q8IV34
Symbols TIE2
VMCM
GLC3E
TIE-2
VMCM1
CD202B

Gene

TEK

 CSPA Cell Line (4)

Protein-protein Interaction (2)

PDB (14)

Gene RIF (191)

AA Sequence

MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQD      1 - 70
PLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVN     71 - 140
ISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRR    141 - 210
CEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFC    211 - 280
LPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTP    281 - 350
KIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG    351 - 420
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYE    421 - 490
AWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLN    491 - 560
LTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLT    561 - 630
AWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLK    631 - 700
GLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIIL    701 - 770
QLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK    771 - 840
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNL    841 - 910
LDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKI    911 - 980
ADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK    981 - 1050
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSA   1051 - 1120
EEAA                                                                     1121 - 1124
//

Text Mined References (245)

PMID Year Title